DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14362 and tesc

DIOPT Version :10

Sequence 1:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001072423.1 Gene:tesc / 779877 XenbaseID:XB-GENE-991111 Length:214 Species:Xenopus tropicalis


Alignment Length:197 Identity:54/197 - (27%)
Similarity:87/197 - (44%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TALSRSQIKYLYIRFHQFSGGGKD----PPSHLHKYNFYSGL--LQLNPLLPTILNSMF------ 79
            |..|..||::|:.||:..||   |    ...||      :|:  |::||:...|:::.|      
 Frog    18 TGFSAEQIEHLHKRFNSLSG---DLLTIRKGHL------NGISDLEVNPIRSKIVDAFFDKRNLR 73

  Fly    80 ----GNKVTITFVDFALFLSTFQAHSLKTSNELKNVMMDKKLRLIFNMYDNNKDGRITKYDLVVV 140
                |....|.|.:|...:|.|:..|.....|..:|....|||.:|||||.:.|.:||..:...|
 Frog    74 KGSSGYVEEINFEEFLTIMSYFRPLSQNMDEENISVCRKDKLRFLFNMYDTDNDSKITLEEYRKV 138

  Fly   141 VHKLFSN--LLDHVQIMRIVNTIMKE-----MDHTDSNQ----IMFQDFCKAFAVFDM-TEMMVT 193
            |.:|.|.  .::......|.:..|.|     :...:.:|    |.|.||.|.:...|: |:|.:.
 Frog   139 VEELLSGNPNIEKETARSIADGAMLEAASICVGQMEPDQVYEGITFDDFLKIWEGIDIETKMHIR 203

  Fly   194 WI 195
            ::
 Frog   204 FL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14362NP_650320.1 EF-hand_7 114..182 CDD:463900 24/78 (31%)
tescNP_001072423.1 FRQ1 <81..>150 CDD:444056 23/68 (34%)

Return to query results.
Submit another query.