DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14362 and Chp1

DIOPT Version :10

Sequence 1:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:183 Identity:46/183 - (25%)
Similarity:81/183 - (44%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EIMNTLRMNTALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNFYS-GLLQLNPLLPTILNSMFG- 80
            |.:..::..|..|.|||..||.||.....|..   ..|.:.:|.. ..|.:|||...|:|:.|. 
  Rat    12 EELEEIKKETGFSHSQITRLYSRFTSLDKGEN---GTLSREDFQRIPELAINPLGDRIINAFFSE 73

  Fly    81 NKVTITFVDFALFLSTFQAHSLKTSNELKNV-------MMDKKLRLIFNMYDNNKDGRITKYDLV 138
            .:..:.|..|...|:.|:  .::.:.:.|:|       ....||...|.:||.:||.:|::.:|:
  Rat    74 GEDQVNFRGFMRTLAHFR--PIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELL 136

  Fly   139 VVVHKLFSNLLDHVQIMRIVNTIMKEMDHTDSNQIMFQDFCKAFAVFDMTEMM 191
            .|:..:....:...|:..|.:..::|.|....:.|.|.:|.|.....|:.:.|
  Rat   137 QVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14362NP_650320.1 EF-hand_7 114..182 CDD:463900 18/67 (27%)
Chp1NP_077053.1 Necessary for association with microtubule and interaction with GAPDH 2..6
FRQ1 27..182 CDD:444056 40/159 (25%)
Nuclear export signal 1 138..147 1/8 (13%)
Nuclear export signal 2 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.