DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and TRIP13

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_004228.1 Gene:TRIP13 / 9319 HGNCID:12307 Length:432 Species:Homo sapiens


Alignment Length:393 Identity:83/393 - (21%)
Similarity:157/393 - (39%) Gaps:75/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 DKKFLGLAVKTLEAVDPR-TVGDSLPKTRNVRFGRILGNTVVQFEKAENSVLNLQGRSKGKIVRQ 211
            |:.||...|:::..:|.. .|.||.|...:   ...:...:.|..:...|..||:..::..|...
Human    62 DEPFLTRNVQSVSIIDTELKVKDSQPIDLS---ACTVALHIFQLNEDGPSSENLEEETENIIAAN 123

  Fly   212 SIINPDWDFGKMGIGGL------DKEFNA-IFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGT 269
            ..:.|..:|     .||      |.|..: :......:.:|..:.|....|...:.:||:|||||
Human   124 HWVLPAAEF-----HGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGPPGT 183

  Fly   270 GKTLMARQIGTMLNAR--------EPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSG 326
            |||.:.:.:...|..|        :...:|...:..|:..||...:.::|.:.::   .:.....
Human   184 GKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQD---LIDDKDA 245

  Fly   327 LHIIIFDEIDAICKARGSVAGNSGVHDT--VVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALL 389
            |..::.||::::..||.:....:...|.  |||.:|.:||.:::.:|::::..:|..:.||.|.:
Human   246 LVFVLIDEVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSNITEKIDVAFV 310

  Fly   390 RPGRLEVQMEISLPNEQG--------------------RVQILNIHTKRMRDFNKIASDVDN--- 431
              .|.:::..|..|:...                    |.|:|.:....|..|  |.::|..   
Human   311 --DRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIGF--IENNVSKLSL 371

  Fly   432 --NEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTRADFLHALDNDIK 494
              |:|:.|::..||..|..|...|.:.    .::|.:             ||...||.||...:.
Human   372 LLNDISRKSEGLSGRVLRKLPFLAHAL----YVQAPT-------------VTIEGFLQALSLAVD 419

  Fly   495 PAF 497
            ..|
Human   420 KQF 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011 6/22 (27%)
AAA 259..404 CDD:214640 36/154 (23%)
AAA 261..402 CDD:278434 36/150 (24%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
TRIP13NP_004228.1 SpoVK <136..360 CDD:223540 46/228 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.