DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and YTA6

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_015251.1 Gene:YTA6 / 856031 SGDID:S000005995 Length:754 Species:Saccharomyces cerevisiae


Alignment Length:319 Identity:94/319 - (29%)
Similarity:155/319 - (48%) Gaps:50/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KAENSVLNLQGRSKG---KIVRQSIINPD---WDFGKMGIGGLDKEFNAIFRRAFASRVFPPELV 250
            :.|:.:.::||..:.   :|:.:.::..:   |:    .|.||....|:: :.|.......|:|.
Yeast   438 RKEDILKSVQGVDRNACEQILNEILVTDEKVYWE----DIAGLRNAKNSL-KEAVVYPFLRPDLF 497

  Fly   251 EQLGIKH-VKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEA 314
            :  |::. |:|:||:||||||||::|:.:.|..|:.... |:...:|.||:||||..:|.||..|
Yeast   498 K--GLREPVRGMLLFGPPGTGKTMIAKAVATESNSTFFS-VSASSLLSKYLGESEKLVRALFYMA 559

  Fly   315 EEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGV-------EQLNN- 371
                |:|.|:    ||..||||::..||......|.  ..:..:||.:...:       |..|| 
Yeast   560 ----KKLSPS----IIFIDEIDSMLTARSDNENESS--RRIKTELLIQWSSLSSATAQSEDRNNT 614

  Fly   372 ----ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIA-SDVDN 431
                :||:|.||....||:|..|  |...::.|.||:.:.|:    .|.||:....|.: .|:|.
Yeast   615 LDSRVLVLGATNLPWAIDDAARR--RFSRKLYIPLPDYETRL----YHLKRLMAKQKNSLQDLDY 673

  Fly   432 NEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLR-VTRADFLHAL 489
            ..|...|:.|||::|..|.:.|....:..|  .|..:..|   .:|:| :...||.:||
Yeast   674 ELITEMTEGFSGSDLTSLAKEAAMEPIRDL--GDKLMFAD---FDKIRGIEIKDFQNAL 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 55/156 (35%)
AAA 261..402 CDD:278434 53/152 (35%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
YTA6NP_015251.1 SpoVK 201..747 CDD:223540 94/319 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.