DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and MSP1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_011542.3 Gene:MSP1 / 852915 SGDID:S000003260 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:95/300 - (31%)
Similarity:144/300 - (48%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KIVRQSIINPD-WDFGKMGIGGLDKEFNAIFRRAFASRVFP---PELVEQLGIKHV-KGILLYGP 266
            :.:..||:.|| .:.....|||||...:.:..    |.::|   ||:.....:... .|:|||||
Yeast    74 RTILSSIVTPDEINITFQDIGGLDPLISDLHE----SVIYPLMMPEVYSNSPLLQAPSGVLLYGP 134

  Fly   267 PGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIII 331
            ||.|||::|:.:.....|....| ....|:||:.|||...:..:|:.|    .:|.|    .||.
Yeast   135 PGCGKTMLAKALAKESGANFISI-RMSSIMDKWYGESNKIVDAMFSLA----NKLQP----CIIF 190

  Fly   332 FDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGVEQLNN--ILVIGMTNRRDMIDEALLRPGRL 394
            .||||:..:.|.|.  :..|..|:..:.:...||:  |||  :::||.|||.:.||:|.||  ||
Yeast   191 IDEIDSFLRERSST--DHEVTATLKAEFMTLWDGL--LNNGRVMIIGATNRINDIDDAFLR--RL 249

  Fly   395 EVQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMN 459
            ..:..:|||....|.:||::   .::|......:.|...||..||.|||::|:.|.|.|...|..
Yeast   250 PKRFLVSLPGSDQRYKILSV---LLKDTKLDEDEFDLQLIADNTKGFSGSDLKELCREAALDAAK 311

  Fly   460 RLIK-----ADS-KVHVDPEAMEKLRVTRA-DFLHALDND 492
            ..||     .|| .:.|:..:..|:|..:. ||...|..|
Yeast   312 EYIKQKRQLIDSGTIDVNDTSSLKIRPLKTKDFTKKLRMD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 53/146 (36%)
AAA 261..402 CDD:278434 50/142 (35%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
MSP1NP_011542.3 MDN1 <10..>164 CDD:227596 28/94 (30%)
RecA-like_ATAD1 92..255 CDD:410928 60/181 (33%)
AAA_lid_3 280..319 CDD:407720 15/38 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.