DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and AT4G24710

DIOPT Version :10

Sequence 1:NP_788676.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_194202.4 Gene:AT4G24710 / 828573 AraportID:AT4G24710 Length:479 Species:Arabidopsis thaliana


Alignment Length:268 Identity:68/268 - (25%)
Similarity:124/268 - (46%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KEFNAIF--------------RRAFASRVFPPELVEQLGIKHVKGILLYGPPGTGKT----LMAR 276
            |||:.::              |.|.::.:|..:.|....:...:.|||:||||||||    .:|:
plant   172 KEFDGLWESLIYESGLKQRLLRYAASALLFTQKGVNPNLVSWNRIILLHGPPGTGKTSLCKALAQ 236

  Fly   277 QIGTMLNAREPKI----VNGPQILDKYVGESEANIRRLFAEAEE--EEKRLGPNSGLHIIIFDEI 335
            ::....|:|.|..    ||...:..|:..||...:.:||.:.:|  ||     :..|..::.||:
plant   237 KLSIRCNSRYPHCQLIEVNAHSLFSKWFSESGKLVAKLFQKIQEMVEE-----DGNLVFVLIDEV 296

  Fly   336 DAICKARGSVAGNSGVHDT--VVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQM 398
            :::..||.:....|...|:  |||.||.::|.::...|::::..:|....||.|.:  .|.:::.
plant   297 ESLAAARKAALSGSEPSDSIRVVNALLTQMDKLKSAPNVIILTTSNITTAIDVAFV--DRADIKA 359

  Fly   399 EISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAK--TKNFSGAELEGLVRAAQSTAMNRL 461
            .:..|....|.:||.             |.|:  |:.:|  ..:|.|.  :||...:.|:...:|
plant   360 YVGPPTLHVRYEILR-------------SCVE--ELISKGIISSFQGC--DGLSIPSFSSLKEKL 407

  Fly   462 IKADSKVH 469
              ::|:||
plant   408 --SESEVH 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_788676.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
RecA-like_NSF-SEC18_r1-like 224..400 CDD:410912 51/195 (26%)
CDC48 <225..>611 CDD:273521 68/268 (25%)
AT4G24710NP_194202.4 RecA-like_Pch2-like 163..361 CDD:410916 51/195 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.