DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and IQCA1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001257514.1 Gene:IQCA1 / 79781 HGNCID:26195 Length:830 Species:Homo sapiens


Alignment Length:286 Identity:52/286 - (18%)
Similarity:97/286 - (33%) Gaps:90/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 VKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLG 322
            ||.:||.||.|.||.::...|.|...|....: :...|..||.|:                    
Human   576 VKSLLLAGPSGVGKKMLVHAICTETGANLFNL-SSSNIAGKYPGK-------------------- 619

  Fly   323 PNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGVEQLN----------------- 370
              :||.:::........:.:.||.   .:.|| ......|:...|::|                 
Human   620 --NGLQMMLHAVFKVARQLQPSVV---WIEDT-EKTFYKKVPNAEKMNEPKRLKKHLPQILKLLK 678

  Fly   371 ---NILVIGMTNRRDMIDEALLRPGRLEVQ---------MEISLPNEQGRV----QILNIHTKRM 419
               .||::|.|.          ||...|:|         :.:..|:...|.    ||:.      
Human   679 PDDRILIVGTTR----------RPFDAELQSFCKVYQKIILVPRPDYASRYVLWKQIIE------ 727

  Fly   420 RDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTRAD 484
            |:...:.|.::.:.:|..|..|:...:..:|:...:....|     .::|..        :|..:
Human   728 RNGGVLTSALNVSCLAKVTDGFTQGHIVEVVKGVLTDQRIR-----RQIHKP--------LTAVE 779

  Fly   485 FLHALDNDIKPAFGAAQEMLENLLAR 510
            |:.|: ..:.|.:...:|..:|..|:
Human   780 FITAI-TSMNPVYKEEEESFKNWYAK 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 32/173 (18%)
AAA 261..402 CDD:278434 31/169 (18%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
IQCA1NP_001257514.1 SpoVK <497..796 CDD:223540 49/276 (18%)
AAA 579..712 CDD:278434 31/169 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.