DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and pex1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_004915478.1 Gene:pex1 / 779516 XenbaseID:XB-GENE-985415 Length:1269 Species:Xenopus tropicalis


Alignment Length:324 Identity:107/324 - (33%)
Similarity:167/324 - (51%) Gaps:36/324 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LVFQFKDKKFLGLAVKTLEAVDPRTVGDSLPKTRNVRFGRILGNTVVQFEKAEN--SVLNLQGRS 204
            |.||:..::..|...:....:..|.:..|:.|.:..|...::.:| ..|::|..  :.|:|:...
 Frog   760 LDFQYLARETEGFVARDFTMLVERAIESSVSKRQICRIEDLVLST-TDFQRALKGFTPLSLRNAQ 823

  Fly   205 KGKIVRQSIINPDWDFGKMGIGGLDKEFNAIFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGT 269
            ..|..:|     ||:.    :||| .:...:.:.........|||...|.|:|..|:||||.|||
 Frog   824 LHKPKKQ-----DWNM----VGGL-HDIRQVLKDTIELPAKYPELFANLPIRHRSGVLLYGAPGT 878

  Fly   270 GKTLMARQIGTMLNAREPKI----VNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHII 330
            ||||:|..|     |.|.::    :.||::|.||:|.||..:|.:|..|:..:.        .|:
 Frog   879 GKTLLAGVI-----AHESRMNFISIKGPELLSKYIGASEQAVRDVFTRAQAAKP--------CIL 930

  Fly   331 IFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLE 395
            .|||.|:|...||.  .|:||.|.||||:|.::||||.|..:.|:..|:|.|:||.||||||||:
 Frog   931 FFDEFDSIAPRRGH--DNTGVTDRVVNQMLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLD 993

  Fly   396 VQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMN 459
            ..:....|::..|.:||    |.:.....:..:||...||:.|..|:||:|:.|:..||..|::
 Frog   994 ECLYCPPPDQDSRFEIL----KGLSHSMLLDENVDLKHIASLTDYFTGADLKALLYNAQLEAIH 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011 5/27 (19%)
AAA 259..404 CDD:214640 63/148 (43%)
AAA 261..402 CDD:278434 62/144 (43%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
pex1XP_004915478.1 PEX-2N 11..93 CDD:370393
PEX-1N 99..174 CDD:370392
CDC48 <587..1052 CDD:273521 106/321 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.