Sequence 1: | NP_001287318.1 | Gene: | Nsf2 / 41694 | FlyBaseID: | FBgn0266464 | Length: | 752 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001201840.1 | Gene: | Fignl2 / 668225 | MGIID: | 3646919 | Length: | 644 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 57/202 - (28%) |
---|---|---|---|
Similarity: | 93/202 - (46%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 ILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNS 325
Fly 326 GLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGV--EQLNNILVIGMTNRRDMIDEAL 388
Fly 389 LRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAA---KTKNFSGAELEGLV 450
Fly 451 RAAQSTA 457 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nsf2 | NP_001287318.1 | CDC48_N | 9..89 | CDD:215012 | |
CDC48_2 | 117..>170 | CDD:215011 | |||
AAA | 259..404 | CDD:214640 | 39/144 (27%) | ||
AAA | 261..402 | CDD:278434 | 38/142 (27%) | ||
AAA | 543..674 | CDD:214640 | |||
P-loop_NTPase | 544..>613 | CDD:304359 | |||
Fignl2 | NP_001201840.1 | SpoVK | <381..638 | CDD:223540 | 57/202 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0464 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |