DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Fignl2

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001201840.1 Gene:Fignl2 / 668225 MGIID:3646919 Length:644 Species:Mus musculus


Alignment Length:202 Identity:57/202 - (28%)
Similarity:93/202 - (46%) Gaps:29/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 ILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNS 325
            :|.:||.|.||.|:.|.:.|.|.|...:: .|..:......|....::..||.|     |..|.:
Mouse   423 VLFFGPRGCGKALLGRCLATRLGATLLRL-RGAGLAASGAVEGARLLQAAFAAA-----RCRPPA 481

  Fly   326 GLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGV--EQLNNILVIGMTNRRDMIDEAL 388
               :::..|:||:..||...|       ::...||..:||.  .:.:.:||:|.|:|...:|||.
Mouse   482 ---VLLISELDALLPARDDGA-------SLRAPLLTCLDGSCGARADGVLVVGTTSRPAALDEAT 536

  Fly   389 LRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAA---KTKNFSGAELEGLV 450
            .|  |..::..::||:...|.|||      .|...:....::..|:||   .|:.|||.||..|.
Mouse   537 RR--RFALRFYVALPDGAARGQIL------QRALAQQGCALNERELAALVQGTQGFSGGELGQLC 593

  Fly   451 RAAQSTA 457
            :.|.:.|
Mouse   594 QQAAAEA 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 39/144 (27%)
AAA 261..402 CDD:278434 38/142 (27%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Fignl2NP_001201840.1 SpoVK <381..638 CDD:223540 57/202 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.