DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Fignl1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_011242039.1 Gene:Fignl1 / 60530 MGIID:1890648 Length:692 Species:Mus musculus


Alignment Length:359 Identity:101/359 - (28%)
Similarity:153/359 - (42%) Gaps:80/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LEAVDPRTV----GDSLPKTRNVRFGRILGNTVVQFEKAENSVLNLQGRSKGKIVRQSIINPDWD 219
            |:.|:||.|    .:.:.....|.:..|.|   |:|.||          :..:||...::.||..
Mouse   394 LKNVEPRMVELIMNEIMDHGPPVHWDDIAG---VEFAKA----------TIKEIVVWPMMRPDIF 445

  Fly   220 FGKMGIGGLDKEFNAIFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNA 284
            .|..|                     ||           |||||:|||||||||:.:.|.:...|
Mouse   446 TGLRG---------------------PP-----------KGILLFGPPGTGKTLIGKCIASQSGA 478

  Fly   285 REPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNS 349
            ....| :...:..|:|||.|..:|.|||.|..::..        :|..||||::...||     .
Mouse   479 TFFSI-SASSLTSKWVGEGEKMVRALFAVARCQQPA--------VIFIDEIDSLLSQRG-----D 529

  Fly   350 GVHDT---VVNQLLAKIDG--VEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRV 409
            |.|::   :..:.|.::||  ....:.|||:|.|||...||||..|  ||..::.|.||....|.
Mouse   530 GEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARR--RLVKRLYIPLPEASARK 592

  Fly   410 QIL-NIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPE 473
            ||: |:.:|.    ....||.:.:.:..::..||||::..|.|.|....:..|..||... :.|:
Mouse   593 QIVGNLMSKE----QCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADIAT-ISPD 652

  Fly   474 AMEKLRVTRADFLHALDNDIKPAFGAAQ-EMLEN 506
            .:..  :...||.:|. ..::|...... |:.||
Mouse   653 QVRP--IAYIDFENAF-KTVRPTVSPKDLELYEN 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011 5/14 (36%)
AAA 259..404 CDD:214640 55/149 (37%)
AAA 261..402 CDD:278434 52/145 (36%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Fignl1XP_011242039.1 RecA-like_Figl-1 398..583 CDD:410933 71/245 (29%)
AAA_lid_3 608..>639 CDD:407720 8/30 (27%)
Vps4_C <649..689 CDD:401324 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.