DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Pex1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001102690.1 Gene:Pex1 / 500006 RGDID:1559939 Length:1283 Species:Rattus norvegicus


Alignment Length:304 Identity:113/304 - (37%)
Similarity:163/304 - (53%) Gaps:35/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RTVGDSLPKTRN-VRFGRILGNTVVQFEKAENSVLNLQGRSKGKIVRQSIINPDWDFGKMGIGGL 228
            |.:..||.:.:| .|.|..|  |...|:||      |:|.....:...::..|. |.|...||||
  Rat   790 RAIHSSLSRQQNPTREGLTL--TTADFQKA------LRGFLPASLRNVNLHKPR-DLGWDKIGGL 845

  Fly   229 DKEFNAIFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI---- 289
             .|...|...........|||...|.|:...||||||||||||||:|..:     |||..:    
  Rat   846 -HEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVV-----ARESGMNFIS 904

  Fly   290 VNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDT 354
            :.||::|.||:|.||..:|.:|..|:..:.        .|:.|||.::|...||.  .|:||.|.
  Rat   905 IQGPELLSKYIGASEQAVRDVFIRAQAAKP--------CILFFDEFESIAPRRGH--DNTGVTDR 959

  Fly   355 VVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRM 419
            ||||||.::||||.|..:.|:..|:|.|:||.||||||||:..:....|::..|::||.:.:|.:
  Rat   960 VVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILTVLSKSL 1024

  Fly   420 RDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAM-NRLI 462
                .:|.|||...:|:.|::|:||:|:.|:..||..|: .||:
  Rat  1025 ----PLADDVDLQHVASVTESFTGADLKALLYNAQLEALQGRLL 1064

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011 1/4 (25%)
AAA 259..404 CDD:214640 65/148 (44%)
AAA 261..402 CDD:278434 64/144 (44%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Pex1NP_001102690.1 PEX-2N 19..98 CDD:286362
PEX-1N 104..179 CDD:286361
AAA 591..741 CDD:214640
AAA 595..724 CDD:278434
AAA 877..1009 CDD:214640 64/146 (44%)
AAA 877..1006 CDD:278434 64/143 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.