DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Pex1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_652016.1 Gene:Pex1 / 45460 FlyBaseID:FBgn0013563 Length:1006 Species:Drosophila melanogaster


Alignment Length:249 Identity:85/249 - (34%)
Similarity:132/249 - (53%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 PELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLF 311
            |.:.....:::..|:|||||||||||.:..|:.|..|.|... |.||::|.||:|:||.|:|.||
  Fly   743 PTIFNASPLRNQAGVLLYGPPGTGKTYLVSQLATSWNLRIIS-VKGPELLAKYIGQSEENVRNLF 806

  Fly   312 AEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGVEQLNNILVIG 376
            ..|.....        .::.|||.|::...||.  .::||.|.||||||.::||||.|..:.||.
  Fly   807 NRARSARP--------CVLFFDEFDSLAPKRGH--DSTGVTDRVVNQLLTELDGVEGLQGVTVIA 861

  Fly   377 MTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIASD------VDNNEIA 435
            .|:|.:::|.||||.||::..:|..||:...||:|          |..::|.      ||.:..|
  Fly   862 ATSRPELLDPALLRSGRIDRLVECPLPDAPARVRI----------FEALSSTLSLDECVDFDWFA 916

  Fly   436 AKTKNFSGAELEGLVRAAQSTAMNRLI------KADSKVHV-DPEAMEKLRVTR 482
            .||.|::||:::.::.:|...|:...:      |...|:.: ....:|..:.||
  Fly   917 GKTANYTGADIQSILTSANMAAVKEALAQFGHEKLAKKISLKQKHLIESFQTTR 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 63/144 (44%)
AAA 261..402 CDD:278434 61/140 (44%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Pex1NP_652016.1 PEX-1N 93..168 CDD:286361
SpoVK 479..974 CDD:223540 85/249 (34%)
P-loop_NTPase 480..604 CDD:304359
AAA 757..887 CDD:278434 61/140 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.