DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and nmd

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:338 Identity:97/338 - (28%)
Similarity:154/338 - (45%) Gaps:59/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PKTRNVRFGRILGNTVVQFEKAENSVLNLQGRS----KGKIVRQSIINPDWDFGKMGIGGLDKEF 232
            |.::|.:..::|....:: ..||.....|:|:.    :..|....::..|.......|.|||   
  Fly    43 PTSKNKKKAKVLAEEQLK-RLAEQEGFKLRGQEFSDYELMIASHLVVPADITVSWADIAGLD--- 103

  Fly   233 NAIFRRAFASRVFPPELVEQLGIKH------VKGILLYGPPGTGKTLMARQIGTMLNAREP--KI 289
             ::.:....|.|.|.:..:.  .||      .||:||:||||.||||:|:     ..|:|.  :.
  Fly   104 -SVIQELRESVVLPIQHKDL--FKHSKLWQAPKGVLLHGPPGCGKTLIAK-----ATAKEAGMRF 160

  Fly   290 VN-GPQIL-DKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVH 352
            :| ...|| ||:.|||:.....:|:.|    .|:.|    .||..||||:..::|     |...|
  Fly   161 INLDVAILTDKWYGESQKLTSAVFSLA----SRIEP----CIIFIDEIDSFLRSR-----NMNDH 212

  Fly   353 DTVV---NQLLAKIDGVEQLNN--ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQIL 412
            :...   .|.:...||:....|  ::|:|.|||...:|:|::|  |:..|..|.||:|..|..||
  Fly   213 EATAMMKTQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDIL 275

  Fly   413 NIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEA--- 474
                |.:....:::.|||.|.::..|..|||::|..:.|.|....|.:||.:.     ||.|   
  Fly   276 ----KLILQSEEVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSR-----DPSATAL 331

  Fly   475 -MEKLRVTRADFL 486
             ...:|:|..|.|
  Fly   332 DRNNVRITMDDLL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 52/153 (34%)
AAA 261..402 CDD:278434 49/149 (33%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
nmdNP_001285801.1 AAA 132..266 CDD:214640 51/153 (33%)
AAA 135..265 CDD:278434 49/149 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.