DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and CG16789

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster


Alignment Length:457 Identity:89/457 - (19%)
Similarity:155/457 - (33%) Gaps:157/457 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 ISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQ---------- 454
            :.||:.:..:.:.| .|.|.:|...:.|.....::....| :...||| ..||..          
  Fly   403 VCLPDIRAEIDLFN-DTWRDKDETGVLSQAAYEDMIYSDK-YQEVELE-FRRAVDDVMRQEIELL 464

  Fly   455 STAMNRLIKADSKVHVDPEAMEKLRVTRADFLHALDNDIKPAFGAAQEMLENLLARGIINWGPP- 518
            .||:.:.:|..||         |.|.:........:.|:.|. ...:.:.|.|:..|||...|. 
  Fly   465 QTAVGKKVKKSSK---------KTRRSGKKSKKKKEKDLTPD-RTTESLYEELVTNGIIRKYPEL 519

  Fly   519 -VTELLEDGMLSVQQAKATESSG-------------------------LVSVLIEGAPNSGKSAL 557
             :.:.|.|..|:. :.....|.|                         :.|:|:.|...|||.||
  Fly   520 RLKQFLGDKALTA-RIGTNPSPGDIRQILTEYCILPLGSDAIHNCTPLIRSILLAGPKGSGKKAL 583

  Fly   558 AANL-----AQLSDFPFVKVCSPEDMVG--------------FTESAKCLHIRKIF-DDAYRSTL 602
            ...:     |.|.|.      :|.::||              ..:.::.|....|| .||.|..:
  Fly   584 LHAICTEVGAVLFDL------TPANIVGKYPGKSGLIMLIHLVLKVSRLLQPAVIFMGDAERPFM 642

  Fly   603 SCI-----------------VVDNV---ERLLDYGPIGPRYSNLTLQALLVLLKK---------Q 638
            ..|                 ::.|:   :|::..|.     |||..:|...||:.         :
  Fly   643 KKIPKTDRTDPKRLKKDLPKLIKNIAPEDRVVFIGT-----SNLPWEADQKLLQSVYNRFIYIPR 702

  Fly   639 PPKGRKLLILCTSSRRDVLEEMEMLSAFTSVLH-----VSNLSTPENVLAVLDDSDLFSP----- 693
            |..|                  .|..|:.::||     :|||.|  :.:|.:.|......     
  Fly   703 PDYG------------------AMSHAWKTLLHDYSGGISNLDT--SAMAKISDGYTIGSIDACL 747

  Fly   694 EELQSIARKMAGKRLCIGIKKLLALI---DMIRQSEPH------------QRVIKFLSKMEEEGG 743
            :|:.:..||:..:...:...:|:.::   |.:.:.|..            :|..:|| ::|||..
  Fly   748 KEVMTCKRKLQLRTQPLTNAELINVLCSRDPVYREEEEAFESWWSKTPLGRRRQRFL-ELEEERL 811

  Fly   744 LE 745
            ||
  Fly   812 LE 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 1/3 (33%)
AAA 261..402 CDD:278434 0/1 (0%)
AAA 543..674 CDD:214640 36/184 (20%)
P-loop_NTPase 544..>613 CDD:304359 21/108 (19%)
CG16789NP_649910.3 AAA 568..704 CDD:214640 30/146 (21%)
AAA 570..702 CDD:278434 29/142 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.