DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and CG4701

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:340 Identity:90/340 - (26%)
Similarity:147/340 - (43%) Gaps:69/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 QFEKAENSVLNLQGRSKGK-------IVRQSIINP-DWDFGKMGIGGLDKEFNAI---------F 236
            |..|..:|.:....:.:.:       ::...::.| |.|.....|.|||.....:         .
  Fly    53 QLRKLNSSAIGAAKKFRARDFNEHEMMIASHLVTPEDIDISWSDIAGLDGTIQELRETVVLPVRH 117

  Fly   237 RRAFA-SRVFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYV 300
            |:.|: |:::          :..||:||:||||.||||:|:.|......|...:..| .:.||:.
  Fly   118 RKLFSRSKLW----------RAPKGVLLHGPPGCGKTLIAKAIAKDAGMRFINLDVG-VLTDKWY 171

  Fly   301 GESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDT---VVNQLLAK 362
            |||:.....:|..|    |:|.|    .||..|||::..:.||     |..|:.   :..|.:.:
  Fly   172 GESQKLATAVFTLA----KKLQP----CIIFIDEIESFLRMRG-----SNDHEATAMIKTQFMLQ 223

  Fly   363 IDGVEQLNNI--LVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKI 425
            .||:....||  ||:|.|||...:|:|:||  |:..|..|.:|.:..|.:||.:    :....::
  Fly   224 WDGLMSNTNICVLVLGATNRPQDLDKAILR--RMPAQFHIGVPRDCQRREILQL----ILQTEQL 282

  Fly   426 ASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIK---------ADSKVHVDPEA------- 474
            :..|:..|:|..|..|||::|..|.|.|....|.:.::         ...|:..|.|.       
  Fly   283 SPSVNLKELARLTIGFSGSDLRELCRHASMYRMRQFMREKLNTGEEIGKDKIEWDFEVKDQALQE 347

  Fly   475 MEKLRVTRADFLHAL 489
            .|.|.:...|.|.:|
  Fly   348 WEHLEIQMEDLLKSL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 53/149 (36%)
AAA 261..402 CDD:278434 51/145 (35%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 27/108 (25%)
AAA 130..265 CDD:214640 53/150 (35%)
AAA 133..265 CDD:278434 51/147 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.