DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and CG5776

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001260420.1 Gene:CG5776 / 34680 FlyBaseID:FBgn0032450 Length:799 Species:Drosophila melanogaster


Alignment Length:514 Identity:134/514 - (26%)
Similarity:221/514 - (42%) Gaps:140/514 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IEKAHRMRAIKCPTDELSLTNKAIVNVSDFTEEVKYVDISPGPGLHYIFALEKISGPELPLGHVG 67
            ||..|.:    ||..|          .||..:.|         .|.::..|:::|.|.       
  Fly   377 IEDVHNL----CPKQE----------NSDLVKRV---------SLAFLSLLDQLSSPS------- 411

  Fly    68 FSLVQRKWATLSINQEIDV------RPYRFDASADIITLVSFETDFLQKKTTTQEPYDSDEMAKE 126
             .|...|...|:.:.:||.      |..|.|...::                             
  Fly   412 -QLKGSKTFVLATSSQIDTLHPSIRRAGRLDNEVEL----------------------------- 446

  Fly   127 FLMQFAGMPLTVGQTLVFQFKDKKFLGLAVKTLEAVDPRTVGDSLPKTRNVRFGRI---LGNTV- 187
                  |.|.:..:           |.:....:::|:.:...:.:....::..|.:   |.|.| 
  Fly   447 ------GAPSSQAR-----------LEIVRCLIKSVEHQLSDEEVEHVASITHGYVGADLANLVY 494

  Fly   188 ---VQFEKAENSVLNLQG---RSKGKIVRQSII---NPDWDFGKMGIGGLDKEFNAIFRRAFASR 243
               :|.:.....:.:||.   |.|...:|:.:|   |..|.    .||| ..|.....::|....
  Fly   495 AAMLQAQPNPLQMPHLQAALTRIKPSAMREVLIECPNVQWS----DIGG-QSELRLAMQQAIEWP 554

  Fly   244 VFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI----VNGPQILDKYVGESE 304
            :...:..::||||..:|||::||||..||::|:.:.|     |.|:    :.||::...:|||||
  Fly   555 LLHADKFQRLGIKPPRGILMFGPPGCSKTMIAKALAT-----ESKLNFLSIKGPELFSMWVGESE 614

  Fly   305 ANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKAR----GSVAGNSGVHDTVVNQLLAKIDG 365
            ..:|.:|.:|    :::.|    .|:.|||||||...|    ||.:|:| |.:.|:.|||.::||
  Fly   615 RAVREVFRKA----RQVAP----AIVFFDEIDAIGGERSEGDGSSSGSS-VKERVLTQLLTELDG 670

  Fly   366 VEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVD 430
            ||.|.|:.::..|||.||||:|||||||::..:.:.||..:.|.:||.|..:.|    .|::|||
  Fly   671 VEALQNVTIVAATNRPDMIDKALLRPGRIDRILYVGLPQCEARREILKIKLRAM----PISNDVD 731

  Fly   431 NNEIAAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTRADFLHAL 489
            ..::...|:.:||||::.:...|...|:.:..:|:.             |...||.|||
  Fly   732 MEKLVQLTEGYSGAEIQAVCHEAALRALEQSFEAED-------------VKWTDFEHAL 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012 16/85 (19%)
CDC48_2 117..>170 CDD:215011 4/52 (8%)
AAA 259..404 CDD:214640 63/152 (41%)
AAA 261..402 CDD:278434 61/148 (41%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
CG5776NP_001260420.1 SpoVK 288..785 CDD:223540 134/514 (26%)
AAA 307..447 CDD:278434 21/135 (16%)
AAA 572..707 CDD:278434 61/148 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.