DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and si:dkey-195m11.8

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:XP_003198869.1 Gene:si:dkey-195m11.8 / 324372 ZFINID:ZDB-GENE-030131-3092 Length:269 Species:Danio rerio


Alignment Length:96 Identity:23/96 - (23%)
Similarity:36/96 - (37%) Gaps:29/96 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GLHYIFALEKISGPELPLGH-VGFSLVQRKWATL------------------SINQE--IDVRPY 89
            |||....|.  ...|||... :||.  |.|.|.:                  |:|:.  .|::.|
Zfish   170 GLHTPTPLH--GAAELPRNRKIGFD--QSKTARVSPYTIRDKSERQNGDSGGSVNESCGTDIQSY 230

  Fly    90 RFDASADIITLVSFETDFLQKKTTTQEPYDS 120
            |.:.   :.||...|.| .:.|::...|.::
Zfish   231 RPER---LSTLPDLEAD-AEGKSSHLRPLET 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012 15/63 (24%)
CDC48_2 117..>170 CDD:215011 1/4 (25%)
AAA 259..404 CDD:214640
AAA 261..402 CDD:278434
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
si:dkey-195m11.8XP_003198869.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.