DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Fign

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001099954.1 Gene:Fign / 295649 RGDID:1308174 Length:759 Species:Rattus norvegicus


Alignment Length:338 Identity:87/338 - (25%)
Similarity:144/338 - (42%) Gaps:64/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 EKAENSVLNLQGRSKGKIVRQSIINP--DWDFGKMGIGGLDKEFNAIFRRAFASRVFPPELVEQL 253
            |:.:|:..:|......:|:.|   .|  ||.    .|.|||     :.:......|..|.|....
  Rat   459 EQLKNTDTHLIDLVTNEIITQ---GPPVDWS----DIAGLD-----LVKAVIKEEVLWPVLRSDA 511

  Fly   254 --GIKHV-KGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAE 315
              |:..: :.|||:||.||||||:.|.|.:.|.|...||. |..::.|::||:|..|...|..|.
  Rat   512 FSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKIA-GSGLVAKWLGEAEKIIHASFLVAR 575

  Fly   316 EEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVV---NQLLAKIDGV--EQLNNILVI 375
            ..:    |:    :|...:||.:..::.|..     |..|.   .:.|.::|.|  ...:.|:||
  Rat   576 CRQ----PS----VIFVSDIDMLLSSQVSEE-----HSPVSRMRTEFLMQLDTVLTSAEDQIVVI 627

  Fly   376 GMTNRRDMIDEALLR--PGRLEVQMEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAKT 438
            ..|::.:.|||:|.|  ..||.:.:..|....|..||:|:.|       |...:|.:...:..:|
  Rat   628 CATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLSQH-------NYCLNDKEFALLVQRT 685

  Fly   439 KNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTRADFLHALDNDIKPA------- 496
            :.|||.::..|.:.|....::.:...|... :.|..:..  :|..||.:|... |:|:       
  Rat   686 EGFSGLDVAHLCQEAAVGPLHAMPATDLSA-IMPSQLRP--ITYQDFENAFCK-IQPSISQKELD 746

  Fly   497 --------FGAAQ 501
                    ||.:|
  Rat   747 MYVEWNKMFGCSQ 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 47/151 (31%)
AAA 261..402 CDD:278434 46/147 (31%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
FignNP_001099954.1 AAA 519..654 CDD:214640 46/148 (31%)
AAA 522..652 CDD:278434 46/143 (32%)
Vps4_C <723..756 CDD:286426 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.