DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and CG31495

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:354 Identity:140/354 - (39%)
Similarity:202/354 - (57%) Gaps:36/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 MEISLPNEQGRVQILNIHTKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNRLI 462
            :.|:|||.:.||.:|.....|:.|.. :|.||...|||.|||||:..||..|||.|       |.
  Fly     2 VNITLPNTEERVNLLKSRINRLGDIT-VAGDVCAREIAMKTKNFTEDELCQLVREA-------LH 58

  Fly   463 KADSKVHVDPEAMEKLRVTRADFLHALDNDIKPAFGAAQEMLENLLARGIINWGPPVTELLEDGM 527
            :|..:.|| ....:.|:||:.|.|.|: ..|:|.||..:|.|:.|:         |...|     
  Fly    59 EAIVRTHV-TRCPKGLQVTQVDLLAAV-KIIQPRFGRQEETLQLLM---------PYEYL----- 107

  Fly   528 LSVQQAKATESSGLVSV--------LIEGAPNSGKSALAANLAQLSDFPFVKVCSPEDMVGFTES 584
                ...|.:.:.|:|.        |:||.|.||.:.:||.:|..:|.||:|..|..:::|.::|
  Fly   108 ----DRTAFDPNDLLSTGRPRWSCHLVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLGLSDS 168

  Fly   585 AKCLHIRKIFDDAYRSTLSCIVVDNVERLLDYGPIGPRYSNLTLQALLVLLKKQPPKGRKLLILC 649
            .||..||::.:|||.|..||:::|:.||::.||.:|.|||...||.|.||||||||...:|:|:|
  Fly   169 EKCQRIREVLEDAYVSRRSCVIIDDFERVIGYGALGKRYSKEFLQKLTVLLKKQPPNSHELIIIC 233

  Fly   650 TSSRRDVLEEMEMLSAFTSVLHVSNLSTPENVLAVLDDSDLFSPEELQSIARKMAGKRLCIGIKK 714
            ||:|.|||||:.:||.||||.:|.|:|||:.::.:::.|..|.||||:.|...|.|:.:.||||:
  Fly   234 TSNRLDVLEELGLLSVFTSVHNVPNVSTPKELMVIVEASKRFEPEELRQIEIAMDGRNVSIGIKR 298

  Fly   715 LLALIDMIRQSEPHQRVIKFLSKMEEEGG 743
            ||.||..:....|.:|..|.|.|:.|..|
  Fly   299 LLDLIAWVNSLNPDRRAAKLLKKLGEAMG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 2/5 (40%)
AAA 261..402 CDD:278434 1/3 (33%)
AAA 543..674 CDD:214640 65/138 (47%)
P-loop_NTPase 544..>613 CDD:304359 28/76 (37%)
CG31495NP_001287320.1 AAA 129..259 CDD:214640 64/129 (50%)
P-loop_NTPase 129..257 CDD:304359 63/127 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S525
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D197562at2759
OrthoFinder 1 1.000 - - FOG0003053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.