DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and Pex6

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_663463.1 Gene:Pex6 / 224824 MGIID:2385054 Length:981 Species:Mus musculus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:150/270 - (55%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 PELVEQLGIKHVKGILLYGPPGTGKTLMARQIG-----TMLNAREPKIVNGPQILDKYVGESEAN 306
            |||: .||::. .|:||:|||||||||:|:.:.     |.|:      |.||::::.|||:||.|
Mouse   729 PELL-SLGLRR-SGLLLHGPPGTGKTLLAKAVATECSLTFLS------VKGPELINMYVGQSEEN 785

  Fly   307 IRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSGVHDTVVNQLLAKIDGVEQLNN 371
            :|.:||.|    :...|    .||.|||:|::..:||....:.||.|.||:||||::||:....:
Mouse   786 VREVFARA----RAAAP----CIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQD 842

  Fly   372 ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQ-GRVQILNIHTKRMRDFNKIASDVD-NNEI 434
            :.|||.|||.|::|.|||||||.:..:.:....:: .::::|:..|::.    |:.:.|. .|.:
Mouse   843 VFVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRKF----KLEASVSLANVL 903

  Fly   435 AAKTKNFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLR-----VTRADFLHALDNDIK 494
            .......:||:|..|...|..||:.|.::       |.|...:||     :|..|.|.|... ::
Mouse   904 DCCPPQLTGADLYSLCSDAMMTALKRRVR-------DLEEGLELRSSALLLTMEDLLQAAAR-LQ 960

  Fly   495 PAFGAAQEML 504
            |:. :.||:|
Mouse   961 PSV-SEQELL 969

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 63/149 (42%)
AAA 261..402 CDD:278434 62/145 (43%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
Pex6NP_663463.1 SpoVK 464..968 CDD:223540 91/267 (34%)
AAA 467..596 CDD:278434
AAA 744..872 CDD:278434 60/141 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.