DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and figl-1

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_504197.1 Gene:figl-1 / 178829 WormBaseID:WBGene00017981 Length:594 Species:Caenorhabditis elegans


Alignment Length:359 Identity:100/359 - (27%)
Similarity:155/359 - (43%) Gaps:92/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KDKKFLGL-AVKTLEAVDPRTVGDSLPKTRNVRFGRILGNTVVQFEKAENSVLNLQGRSKGKIVR 210
            ||:|..|| |..||:..|...:  ||.::..:.....:|..         .|..|:|..|.  :|
 Worm   278 KDEKMSGLRAEPTLKHFDENII--SLIESEIMSVNNEIGWA---------DVAGLEGAKKA--LR 329

  Fly   211 QSIINPDWDFGKMGIGGLDKEFNAIFRR--AFASRVFPPELVEQLGIKHVKGILLYGPPGTGKTL 273
            :.::.|                   |:|  .|.....||           ||:||:||||||||:
 Worm   330 EIVVLP-------------------FKRPDVFTGIRAPP-----------KGVLLFGPPGTGKTM 364

  Fly   274 MARQIGTMLNAREPKIVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAI 338
            :.|.:.:...|....| :...:..|:|||.|..:|.||:.|     ||...|   :|..||||::
 Worm   365 IGRCVASQCKATFFNI-SASSLTSKWVGEGEKLVRALFSVA-----RLKLPS---VIFIDEIDSL 420

  Fly   339 CKARGSVAGNSGVHDT---VVNQLLAKIDGVEQL--NNILVIGMTNRRDMIDEALLRPGRLEVQM 398
            ..:|     :...|::   :..:.|.::|||...  ..:||:|.|||...:|||..|  |.:.::
 Worm   421 LSSR-----SESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQELDEAARR--RFQKRL 478

  Fly   399 EISLPNEQGRVQI---LNIHTKRMRDFNKIASDVDNN---EIAAKTKNFSGAELEGLVRAAQSTA 457
            .|:||..:.|.||   |.:.|:.         |:.|:   .|...|..:|||::..|...|   |
 Worm   479 YIALPEPESRTQIVQNLLVGTRH---------DITNHNLERIRELTDGYSGADMRQLCTEA---A 531

  Fly   458 MNRLIKADSKVHVDPEAMEK--LR-VTRADFLHA 488
            |..:    ..:..|.|.::|  :| ||..||..|
 Worm   532 MGPI----RDIGDDIETIDKDDIRAVTVMDFAEA 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011 9/23 (39%)
AAA 259..404 CDD:214640 51/149 (34%)
AAA 261..402 CDD:278434 48/145 (33%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
figl-1NP_504197.1 P-loop_NTPase 315..>371 CDD:304359 24/96 (25%)
AAA 348..484 CDD:214640 53/162 (33%)
AAA 352..480 CDD:278434 47/143 (33%)
Vps4_C <545..585 CDD:286426 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.