DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsf2 and pch-2

DIOPT Version :9

Sequence 1:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster
Sequence 2:NP_495711.1 Gene:pch-2 / 174313 WormBaseID:WBGene00008641 Length:424 Species:Caenorhabditis elegans


Alignment Length:303 Identity:69/303 - (22%)
Similarity:133/303 - (43%) Gaps:62/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 EFNAIFRRAFASRVFPPELVE------QLGIKHV--------KGILLYGPPGTGKTL----MARQ 277
            ||::|:...........|::.      :|..|||        :.|||.||||||||.    :|:.
 Worm   131 EFDSIWENLIYDSNLKNEVMSYVAALARLSEKHVNTKIINVNRLILLTGPPGTGKTSLCKGLAQH 195

  Fly   278 IGTMLNAREPKIV----NGPQILDKYVGESEANIRRLFAEAEE--EEKRLGPNSGLHIIIFDEID 336
            :...:|.:..|.|    |...:..|:..||...::::|.:.:|  |:::.     :..::.||::
 Worm   196 LSIRMNDKYSKSVMLEINSHSLFSKWFSESGKLVQKMFDQIDELAEDEKC-----MVFVLIDEVE 255

  Fly   337 AICKARGSVAGNSGVHDTV--VNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQME 399
            ::...|.|.:..|...|.:  ||.||.:||.:.:.:|:|::..:|....:|:||:  .|.::...
 Worm   256 SLGMCRESSSSRSEPSDAIRAVNALLTQIDRIRRRDNVLILCTSNLESTLDKALV--DRADIVKN 318

  Fly   400 ISLPNEQGRVQILNIHTKRMRDFNKIASDVDN------------------NE-------IAAKTK 439
            :..|::..|..:|.   ..:.:..:|...:||                  ||       ||.:.:
 Worm   319 VGQPSDFARYSMLK---SSIMELARIGVVIDNEVHTDYWPQDICDTKAPRNEFTEILFKIAQEAR 380

  Fly   440 NFSGAELEGLVRAAQSTAMNRLIKADSKVHVDPEAMEKLRVTR 482
            ..||..:..|.....|.:....|...:.:::..||: |.|::|
 Worm   381 GLSGRAISMLPTLVYSKSPEETITLPNCMNLFLEAV-KERLSR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 41/156 (26%)
AAA 261..402 CDD:278434 41/152 (27%)
AAA 543..674 CDD:214640
P-loop_NTPase 544..>613 CDD:304359
pch-2NP_495711.1 AAA 172..322 CDD:214640 41/156 (26%)
AAA 175..320 CDD:278434 41/151 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.