DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and AT1G75980

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_177725.1 Gene:AT1G75980 / 843930 AraportID:AT1G75980 Length:225 Species:Arabidopsis thaliana


Alignment Length:178 Identity:60/178 - (33%)
Similarity:96/178 - (53%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EHEEQEICGKLVAPITDSFQEDYPSVVDRFFTRYY---YFKGDVPYQVLYHSNRICLICLAPEHP 76
            |.||::...||:...........||.....|..|:   :.|......:..|:|.:|:|.|||.|.
plant    44 EDEEEDELRKLLLSDIGELPISPPSATQVNFVSYFITDFTKSGHDQYIYRHANGLCVIGLAPTHI 108

  Fly    77 ALAQ--GISSVNFDIGNVDRSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVE 139
            |...  ||:||:|::|..|||...|.||.||..:..::.:.|..::||. .||.|..|::|.|:|
plant   109 AFKDEGGITSVDFNVGKSDRSVLKVSGKRKKNALRSESNTALCKVSTAK-DTYIVRCCVKGSLLE 172

  Fly   140 VNTAIVEEPKLLEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEER 187
            ||..::::|:||....:..||.||::|:..:....|.||:|.|:|:|:
plant   173 VNERLIKQPELLNSTADREGYIAIIMPRPADWTKNKESLITLEEYKEK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 22/59 (37%)
AT1G75980NP_177725.1 Biotinyl_lipoyl_domains 89..220 CDD:416260 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4032
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56788
Inparanoid 1 1.050 98 1.000 Inparanoid score I2196
OMA 1 1.010 - - QHG53738
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto3507
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.