DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and abitram

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001038394.1 Gene:abitram / 560419 ZFINID:ZDB-GENE-060503-602 Length:177 Species:Danio rerio


Alignment Length:171 Identity:71/171 - (41%)
Similarity:102/171 - (59%) Gaps:9/171 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DSFQEDYPSVVDRFFTRYYY--FKGDVPYQ---VLYHSNRICLICLAPEHPALAQG--ISSVNFD 88
            |..::..|||:||:|||:|.  .||. |.:   :|.||||||:|.||..||....|  |.::|:.
Zfish     3 DKEEKKAPSVIDRYFTRWYRTDLKGK-PCEDHCILQHSNRICVITLAESHPIFQNGRKIKNINYQ 66

  Fly    89 IGN-VDRSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKLLE 152
            |.: ..|.:|.|.||.|:||..|...:.|..:|..:...:.:.|||||:|:|||..|:.:|.||.
Zfish    67 ISDGCSRLKNKVSGKSKRGGQFLTEFAPLCRITCTDEQEFTIFSCIRGRLLEVNEVILNKPDLLM 131

  Fly   153 QLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNE 193
            :.|...||.|::|||.|...::...|||:|||||.|..:|:
Zfish   132 EKPSTEGYIAVILPKFEESKSVTEGLLTREQYEEILTKRNQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 29/59 (49%)
abitramNP_001038394.1 Biotinyl_lipoyl_domains <108..167 CDD:299706 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590642
Domainoid 1 1.000 65 1.000 Domainoid score I10082
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56788
Inparanoid 1 1.050 127 1.000 Inparanoid score I4664
OMA 1 1.010 - - QHG53738
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto39821
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2921
SonicParanoid 1 1.000 - - X5162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.