DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and ABITRAM

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_060302.1 Gene:ABITRAM / 54942 HGNCID:1364 Length:181 Species:Homo sapiens


Alignment Length:158 Identity:71/158 - (44%)
Similarity:97/158 - (61%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSVVDRFFTRYYYFKGDV------PYQVLYHSNRICLICLAPEHPALAQG--ISSVNFDIG-NVD 93
            ||:|||:|||:|  |.||      .:.:|.||||||:|.||..||.|..|  |.|:::.|. |..
Human    13 PSLVDRYFTRWY--KPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCS 75

  Fly    94 RSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKLLEQLPEGA 158
            |.||.|.||.|:|...|...:.|..:..::|..|.|.||:||:|:|||..|:.:|.:|::.|...
Human    76 RLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTE 140

  Fly   159 GYFAILLPKIENCDAIKASLLTQEQYEE 186
            ||.|::|||.|...:|...||||:||||
Human   141 GYIAVVLPKFEESKSITEGLLTQKQYEE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 29/58 (50%)
ABITRAMNP_060302.1 Biotinyl_lipoyl_domains <115..171 CDD:325020 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155486
Domainoid 1 1.000 66 1.000 Domainoid score I10009
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56788
Inparanoid 1 1.050 127 1.000 Inparanoid score I4698
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53738
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto90946
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2921
SonicParanoid 1 1.000 - - X5162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.