DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and Abitram

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_002729524.1 Gene:Abitram / 298018 RGDID:1594560 Length:193 Species:Rattus norvegicus


Alignment Length:179 Identity:77/179 - (43%)
Similarity:107/179 - (59%) Gaps:12/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVAP-ITDSFQEDYPSVVDRFFTRYYYFKGDV------PYQVLYHSNRICLICLAPEHPALAQG- 81
            :||| :..|.:...||:|||:|||:|  |.||      .:.:|.||||||:|.||..||.|..| 
  Rat    11 VVAPEVVMSTEPPAPSLVDRYFTRWY--KADVKGKPCEDHCILQHSNRICVITLAGSHPVLQSGK 73

  Fly    82 -ISSVNFDI-GNVDRSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAI 144
             |.|:::.| .|..|.||.|.||.|:|...|...:.|..:..::|..|.:.|||||:|:|||..|
  Rat    74 TIKSISYQISNNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTISSCIRGRLMEVNENI 138

  Fly   145 VEEPKLLEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNE 193
            :.:|.||::.|...||.|::|||.|...:|...||||:||||.|..:.:
  Rat   139 LHQPSLLQEKPSTEGYIAVVLPKFEESKSITEGLLTQQQYEEVLVKRTD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 30/59 (51%)
AbitramXP_002729524.1 Biotinyl_lipoyl_domains <123..183 CDD:299706 30/59 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349370
Domainoid 1 1.000 67 1.000 Domainoid score I9652
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56788
Inparanoid 1 1.050 132 1.000 Inparanoid score I4528
OMA 1 1.010 - - QHG53738
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto98043
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.