DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and Abitram

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001074889.1 Gene:Abitram / 230234 MGIID:2677850 Length:193 Species:Mus musculus


Alignment Length:173 Identity:71/173 - (41%)
Similarity:102/173 - (58%) Gaps:12/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLVAP-ITDSFQEDYPSVVDRFFTRYYYFKGDV------PYQVLYHSNRICLICLAPEHPALAQG 81
            ||..| :..:.:...||:|||:|||:|  |.||      .:.:|.||||||:|.||..||.|..|
Mouse    10 KLAPPEVVIATEAPPPSLVDRYFTRWY--KADVKGKPCEDHCILQHSNRICVITLAGSHPVLQSG 72

  Fly    82 --ISSVNFDI-GNVDRSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTA 143
              |..:::.| .|..|.:|.|.||.|:|...|...:.|..:..::|..|.:.||:||:|:|||..
Mouse    73 KAIQRISYQISNNCSRLENKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTISSCVRGRLMEVNEN 137

  Fly   144 IVEEPKLLEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEE 186
            |:.:|.||::.|...||.|::|||.|...::...||||:||||
Mouse   138 ILHQPSLLQEKPSTEGYIAVVLPKFEESKSVTEGLLTQQQYEE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 28/58 (48%)
AbitramNP_001074889.1 Biotinyl_lipoyl_domains <123..183 CDD:299706 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845939
Domainoid 1 1.000 66 1.000 Domainoid score I9980
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56788
Inparanoid 1 1.050 124 1.000 Inparanoid score I4684
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53738
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto94532
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2921
SonicParanoid 1 1.000 - - X5162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.