DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9288 and F54F2.7

DIOPT Version :9

Sequence 1:NP_650316.1 Gene:CG9288 / 41689 FlyBaseID:FBgn0260464 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_498946.1 Gene:F54F2.7 / 176238 WormBaseID:WBGene00018835 Length:157 Species:Caenorhabditis elegans


Alignment Length:138 Identity:46/138 - (33%)
Similarity:65/138 - (47%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YPSVVDRFFTRYYYFKGDVPYQ---VLYHSNRICLICL--APEHPALAQGISSVNFDIG-----N 91
            |.|||||.::|    |....|.   .|:|.:.:.::.|  .||...       |..|.|     .
 Worm     6 YASVVDRIYSR----KSSELYDNIAYLHHPSGVTVVVLRNIPESEV-------VEVDFGTTKKHG 59

  Fly    92 VDRSQNVVKGKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKLLEQLPE 156
            .|||.|.|.||||||.:|||.:|.|......:|..:.|.:.:||.|||:|..:...|..:...|:
 Worm    60 ADRSTNQVSGKGKKGALILQPDSKLCTFKCKDGSEHVVRAGVRGTLVEMNDRLKTTPDFIRTAPD 124

  Fly   157 GAGYFAIL 164
            ..|:.||:
 Worm   125 NQGFIAII 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9288NP_650316.1 Biotinyl_lipoyl_domains <129..189 CDD:299706 12/36 (33%)
F54F2.7NP_498946.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164056
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3266
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I3971
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006221
OrthoInspector 1 1.000 - - oto18944
orthoMCL 1 0.900 - - OOG6_104035
Panther 1 1.100 - - LDO PTHR13651
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2921
SonicParanoid 1 1.000 - - X5162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.