DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9297 and EHD1

DIOPT Version :9

Sequence 1:NP_001262553.1 Gene:CG9297 / 41688 FlyBaseID:FBgn0038181 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_001030731.1 Gene:EHD1 / 821573 AraportID:AT3G20290 Length:545 Species:Arabidopsis thaliana


Alignment Length:424 Identity:112/424 - (26%)
Similarity:214/424 - (50%) Gaps:46/424 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 FNAREKATDNVAEI--ILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSG 583
            |:::.....:::.:  |:..:||:|...:||||..|::.|..:...::.:..:||:::.:|.:|.
plant   144 FSSKSSKKISLSSVTSIVDGLKRLYIQKLKPLEVAYRFNDFVSPLLTNSDFDAKPMVMLLGQYST 208

  Fly   584 GKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLA--ADYTFAGLQKFGQGL 646
            ||::.:.:|..:.| |.: ..|.||:...|.::|.|.:...:.|..:|  ||..|:||..||...
plant   209 GKTTFIKHLLKSTY-PGA-HIGPEPTTDRFVVVMSGPDERSIPGNTVAVQADMPFSGLTTFGTAF 271

  Fly   647 EERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVG 710
            ..:....:|...:||.|..|:.||:|...|| ..|.:.|.....||..:.|:|.|::||.||||.
plant   272 LSKFECSQMPHPLLEHVTFVDTPGVLSGEKQRTQRAYDFTGVTSWFASKCDLILLLFDPHKLDVS 336

  Fly   711 PETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHPY 775
            .|.:.::..|:|.:.:.|::|||||.|..::|:||.|||:|::..::::.:...:|..|....|.
plant   337 DEFKRVISSLRGHDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVLNTPEVSRVYIGSFSDKPI 401

  Fly   776 QDGAP---ARLLLAQER----AFLRDL-RTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLNTFN 832
            .:.|.   .|.|..:|:    |.|:|: :.|.|:||...:..||  |.::  ||.::.   :...
plant   402 NEAATGPIGRELFEKEQDDLLADLKDIPKKACDRRINEFVKRAR--AAKI--HAYIIS---HLKK 459

  Fly   833 NHKTLFGNKK---RIADDIIDH----PQNYHIYEGLSTLTNISRYDLPDPEVYRDFFRLNPLYEF 890
            ....:.|..|   ::.|::.|.    .:.:|:.:|          |.|:.:.:|:......:.:|
plant   460 EMPAIMGKAKAQQKLIDNLEDEFGKVQREHHLPKG----------DFPNVDHFREVLSGYNIDKF 514

  Fly   891 KKLRDTCTYFRGCPITKLDLAIAYELPELAGKYK 924
            :||:...       :..:|..:.|::|||...:|
plant   515 EKLKPKM-------LQTVDDMLGYDIPELLKNFK 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9297NP_001262553.1 TSP3 repeat_long 167..205 CDD:275366
EHD_N 539..569 CDD:293485 9/29 (31%)
EHD 574..813 CDD:206740 78/249 (31%)
EHD1NP_001030731.1 EH 19..85 CDD:238009
EHD_N 163..195 CDD:407121 9/31 (29%)
EHD 199..443 CDD:206740 76/245 (31%)
DUF5600 435..537 CDD:407981 23/125 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1954
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11216
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.