DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9297 and Ehd4

DIOPT Version :9

Sequence 1:NP_001262553.1 Gene:CG9297 / 41688 FlyBaseID:FBgn0038181 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_647540.1 Gene:Ehd4 / 192204 RGDID:628883 Length:541 Species:Rattus norvegicus


Alignment Length:382 Identity:107/382 - (28%)
Similarity:193/382 - (50%) Gaps:19/382 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 LDEEFNAREKATD-NVAEIILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGP 580
            :..:...||::.. :..:.:...::.:|:..|.|||..|::.:..:....|.:..:||:||.:|.
  Rat     5 MGRQAGGRERSGGMDAVQTVTGGLRSLYQRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQ 69

  Fly   581 WSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAAD--YTFAGLQKFG 643
            :|.||::.:.||.:.::.  .:|.|.||:...|..:|:|.......|..|..|  ..|..|.:||
  Rat    70 YSTGKTTFIRYLLEQDFP--GMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFG 132

  Fly   644 QGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKL 707
            .....|....::.:::|:.::|::.||||...|| :||.:.|....|||.:|.|.|.|::|..||
  Rat   133 NAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKL 197

  Fly   708 DVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWT 772
            |:..|....:...:|::.:.|::|||||.|..::|:||.|||:|::..::::.:...:|..|.|.
  Rat   198 DISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWA 262

  Fly   773 HPYQDGAPARLLLAQERAFLRDLRTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLNTFNNHKTL 837
            .|.|:....||..|:.:...||:::...|....|:....:.|...:.||.::. ||.  ....::
  Rat   263 QPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIIS-YLK--KEMPSM 324

  Fly   838 FG--NKKRIADDIIDHPQNYHIYEGLSTLTNISRYDLPDPEVYRDFFRLNPLYEFKK 892
            ||  ||||  :.|...|:   ||..|.....||..|.|:.:..::...   .|:|.|
  Rat   325 FGKENKKR--ELIFRLPE---IYVQLQREYQISAGDFPEVKAMQEQLE---NYDFTK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9297NP_001262553.1 TSP3 repeat_long 167..205 CDD:275366
EHD_N 539..569 CDD:293485 7/29 (24%)
EHD 574..813 CDD:206740 73/241 (30%)
Ehd4NP_647540.1 EHD_N 27..59 CDD:407121 7/31 (23%)
EHD 63..303 CDD:206740 73/241 (30%)
DUF5600 291..397 CDD:407981 25/94 (27%)
EH 441..534 CDD:197477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1954
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D377342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.