DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and ChiC

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana


Alignment Length:360 Identity:103/360 - (28%)
Similarity:165/360 - (45%) Gaps:43/360 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AVYRTGIGRYGLEDVPADLCTHIIYSFIGVNDKSWDVLVIDPELDVDQGGFSKFTQ-LKKSNPNV 100
            |.|......:.:.|:.:.|.||:..:|..:|.::..|.|    ...:|..||.||| :::.||:|
plant    30 ASYWFPASEFPVTDIDSSLFTHLFCAFADLNSQTNQVTV----SSANQPKFSTFTQTVQRRNPSV 90

  Fly   101 KLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRGGNYGDKD 165
            |..:::||.....:.|:.|.:....|:|||.|.:|..:.|.|.|.|||||||.:.....|:|.  
plant    91 KTLLSIGGGIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYPSSATEMTNFGT-- 153

  Fly   166 KFLYFVEELRRAFDRE-GRGWEITMAVPVAKFRLNEGYH----VPELCEALDAIHAMTYDLRGNW 225
                .:.|.|.|...| ....:..:.:..|.|..|..|.    |..:..:||.::.|.||..|  
plant   154 ----LLREWRSAVVAEASSSGKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYG-- 212

  Fly   226 AGFADVHSPLYKRKHDQYAYEKLNV----NDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKN 286
            .|::.|..|      ....::..|.    :.|...|.:.|.||.|.|:|.|:||..:.|:|:|.:
plant   213 PGWSRVTGP------PAALFDPSNAGPSGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANSH 271

  Fly   287 YNMGTYINKEAGGGAP--GPYTNASGFLAYYEICTEVMDKSKGWTVEWDDAGMVPYTYKDTQWVG 349
                :|.       ||  |...:..|.:.|.:|...::|  .|.|..::...:..|.|..|.|:|
plant   272 ----SYY-------APTTGAAISPDGSIGYGQIRKFIVD--NGATTVYNSTVVGDYCYAGTNWIG 323

  Fly   350 YENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHGM 384
            |::..||..|:.:.||||..|..:|.:..||..|:
plant   324 YDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 100/353 (28%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 103/360 (29%)
Trypan_PARP 367..469 CDD:114603 6/18 (33%)
CBM_14 531..578 CDD:279884
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 103/360 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.