DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and AT4G19770

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:263 Identity:80/263 - (30%)
Similarity:126/263 - (47%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWEITMA 190
            |:|||.|.:...:.|.|||.|||||||      .|..:...|...::|.|.|...|....|:.:.
plant     8 RKSFILSTISIARSYGFDGLDLDWEYP------RNAAEMSDFAELLKEWRYAVQGEAYSSELPVL 66

  Fly   191 VPVAKFRLNEGYH-----VPELCEALDAIHAMTYDLRGNWAGFADVHSP---LYKRKHDQYAYEK 247
            :..|....:..|:     |..:.|.||.::...||..|  .|..:|..|   ||.:.      :.
plant    67 ILTATVYYSSNYNGVVYPVKFISELLDWVNIKAYDFYG--PGCTEVTGPPAALYLQS------DG 123

  Fly   248 LNVNDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFL 312
            .:.:.|:..|.:.|.||.|.|:|.|:||..:||::..   |.|.|::      ..||..:..|.:
plant   124 PSGDSGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPK---NHGYYVD------TTGPAISDDGEI 179

  Fly   313 AYYEICTEVMDKSKGWTVEWDDAGMVPYTYKDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAID 377
            :|.::.|.::| :|..||. |:..:..|.|..|.|:||::|.||..|:.:.||:|..|..:|.:.
plant   180 SYSQLKTWIVD-NKATTVH-DNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQVG 242

  Fly   378 MDD 380
            .||
plant   243 GDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 78/260 (30%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 80/263 (30%)
Trypan_PARP 367..469 CDD:114603 5/14 (36%)
CBM_14 531..578 CDD:279884
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 80/263 (30%)
Glyco_18 <1..244 CDD:214753 78/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1632
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.