DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and AT4G19740

DIOPT Version :10

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:211 Identity:53/211 - (25%)
Similarity:83/211 - (39%) Gaps:26/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 MVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREG- 182
            |.:.|..|:|||.|.:...:...|.|.||.||||.......|:|.      .::|.|.|.:.|. 
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPNNDVEMNNFGK------LLQEWRSAVEVESQ 59

  Fly   183 ----RGWEITMAVPVAKFRLNEGYHVPELCEALDAIHAMTYDLRGNWAGF---ADVHSPLYKRKH 240
                |...:|.||.......:..|.|..:..:||.::.:.|:..|.....   |.::.|..|...
plant    60 RTGIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTEIGPPAGLYDPSIKGPC 124

  Fly   241 DQYAYEKLNVNDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGP- 304
            .         :.||..|.:.|.|..|.|.|.|:.|.::|| :.:|::.....:.......|.|. 
plant   125 G---------DTGLKHWLKAGLPEKKAVFGFPYVGWSWTL-DDDKDHGDDVAVTHRVAVTANGSI 179

  Fly   305 -YTNASGFLAYYEICT 319
             |.....|:..|:..|
plant   180 NYDQIVKFITEYKART 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 GH18_chitolectin_chitotriosidase 29..397 CDD:119351 53/211 (25%)
PTZ00449 <400..546 CDD:185628
CBM_14 531..578 CDD:426342
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:471972 46/189 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.