DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and Ctbs

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_112285.1 Gene:Ctbs / 81652 RGDID:621338 Length:367 Species:Rattus norvegicus


Alignment Length:381 Identity:92/381 - (24%)
Similarity:145/381 - (38%) Gaps:98/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RYGLEDVP---ADLCTHIIYSFIGVNDKSWDVLVIDPELDVDQGGFSKF--TQLKKSNPNVKLEI 104
            |...||.|   |.||..|.:      .:.::|.|    .||.|..:..:  :|:        ..:
  Rat    20 RLSAEDCPCSEASLCRPIRH------HRDFEVFV----FDVGQKTWKSYDWSQI--------TTV 66

  Fly   105 AVGGWAEGGSKY-SQM----------------VAVRD-----RRQSFIRSVVRFMKQYNFDGFDL 147
            ||.|      || |::                ||::|     .|.|:|...|...|..:.||.::
  Rat    67 AVFG------KYDSELMCYAHSKGARVVLKGDVALKDIINPTFRASWIAQKVALAKAQHMDGINI 125

  Fly   148 DW---------EYPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWEITMAVPVAKFRLNEG-Y 202
            |.         ||...|             ..|.|....|.||..|.::|..|..:...:::. |
  Rat   126 DIEQEVDCSSPEYEALT-------------ALVRETTEGFHREIEGSQVTFDVAWSPKGIDKRCY 177

  Fly   203 HVPELCEALDAIHAMTYDLRGN-WAG-FADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPAN 265
            :...:.:|.|.:..|:||.:.. |:. .|..::|        |........|.|    .||....
  Rat   178 NYTGIADACDFLFVMSYDEQSQIWSECIAAANAP--------YNQTLTGYGDYL----RMGISPR 230

  Fly   266 KLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFLAYYEICTEVMDKSKGWTV 330
            |||:|:|:||..:...|.:|:....  |.|....||  |.::|:|....|.:..:.::.|...: 
  Rat   231 KLVMGIPWYGYDYICLNLSKDDVCA--IAKVPFRGA--PCSDAAGHQVPYRVIMKQVNSSVSGS- 290

  Fly   331 EWDDAGMVP-YTYKD----TQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDF 381
            :|:.....| |.|||    ...|.|:|..||.:|..|:|..|..|...|..:..|:
  Rat   291 QWNQDQQAPYYNYKDPTGRLHQVWYDNPRSISLKAAFVKHYGLRGIGMWNANCLDY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 91/377 (24%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 92/381 (24%)
Trypan_PARP 367..469 CDD:114603 4/15 (27%)
CBM_14 531..578 CDD:279884
CtbsNP_112285.1 GH18_chitobiase 23..363 CDD:119354 91/378 (24%)
Glyco_18 <100..343 CDD:214753 68/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.