DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and Idgf1

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_477258.1 Gene:Idgf1 / 34978 FlyBaseID:FBgn0020416 Length:439 Species:Drosophila melanogaster


Alignment Length:446 Identity:112/446 - (25%)
Similarity:199/446 - (44%) Gaps:78/446 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRYIPLLLLGVLCSWPAATVASDQASRIVCYFSNWAVYRTGIGRYGLE--DVPADLCTHIIYSFI 64
            :|:....:||:|    :.|..:..||.::||:.:.:..|.|:.:....  |:....|||::|.:.
  Fly     1 MRFQLFYILGLL----SVTSLTHAASNLICYYDSNSYLRQGLAKMHTNELDLALQFCTHLVYGYA 61

  Fly    65 GVNDKSWDVLVIDPELDVDQGGFSKFTQLKKSNPNVKLEIAVGGWAE----GGSKYSQMV-AVRD 124
            |:  ||..:.:....:|:|...:...|.|::..|.:|:.::|||..:    ..:||.::: |.|.
  Fly    62 GL--KSGTLELFSLNVDLDMFYYKDITALRQKFPQLKILLSVGGDRDVDEAHPNKYVELLEANRT 124

  Fly   125 RRQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRG-----GNY---------GD----------KD 165
            .:|:||.|.:..:|:..|||.||.::.|....|.     |:|         ||          |.
  Fly   125 AQQNFIDSSMILLKRNGFDGLDLAFQLPRNKPRKVHGSLGSYWKSFKKLFTGDFVVDPQAEEHKS 189

  Fly   166 KFLYFVEELRRAFDREGRGWEITMAVPVAKFRLNEGYH--VPELCEALDAIHAMTYD----LRGN 224
            :|...|..::.||    |...:.:::.|.. .:|..::  ||:|....|.|:...:|    ||. 
  Fly   190 QFTDLVGNIKNAF----RSANLMLSLTVLP-NVNSTWYFDVPKLHPQFDYINLAAFDFLTPLRN- 248

  Fly   225 WAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNM 289
             ...||..:|:: .:.:|.....|||...:..|.:..||..||.:|:..|||.:.||..:.  ..
  Fly   249 -PEEADFTAPIF-FQDEQNRLPHLNVEFQINYWLQNHCPGQKLNLGIASYGRAWKLSKGSG--LS 309

  Fly   290 GTYINKEAGGGAPG--PYTNASGFLAYYEICTEV--------------MDKSKGWTVEWDDAGMV 338
            |..|..|..|.|||  ...:|.|.|::.|||:::              :.|....|.::.:..:.
  Fly   310 GAPIVHETCGVAPGGIQIQSAEGLLSWPEICSKLSQNASAQYRGELAPLRKVTDLTQKYGNYALR 374

  Fly   339 PYTYKDTQ-----WVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHGMC-GRK 388
            |   .|..     |:.:::.....||..:.|.:|..|...:.:..|||.|:| |:|
  Fly   375 P---ADDNGDFGVWLSFDDPDFAGIKAVYAKGKGLGGIALFDLSYDDFRGLCTGQK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 98/408 (24%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 105/419 (25%)
Trypan_PARP 367..469 CDD:114603 9/23 (39%)
CBM_14 531..578 CDD:279884
Idgf1NP_477258.1 GH18_IDGF 23..438 CDD:119352 105/420 (25%)
Glyco_18 24..417 CDD:214753 98/407 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.