DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and Cht11

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster


Alignment Length:411 Identity:117/411 - (28%)
Similarity:183/411 - (44%) Gaps:52/411 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YIPLLLLGVLCSWPAATVASDQASRIVCYFSNWAVYRTGIGRYGLEDVPADLCTHIIYSFIGVND 68
            :|.|.|||:     ..........|:|||:::     .|.....|.|||.|||||     |.:..
  Fly    49 FIGLGLLGI-----QTGEVHKVGQRLVCYYAS-----DGTHNLSLLDVPGDLCTH-----INIGP 98

  Fly    69 KSWD---VLVIDPELDVDQGGFSKFTQLKKSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFI 130
            .:.|   :::.|....|.|.....|   :.::|.|.|.:.:|| |:.|..::.|||....|:.|:
  Fly    99 ATLDNATIVLPDTLRQVLQNDTRSF---RAAHPQVHLLLWIGG-ADSGRSFALMVANHAMRKLFL 159

  Fly   131 RSVVRFMKQY-NFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWEI-TMAVPV 193
            ||:...::.| :.||.|||||:|.|.||...:  ..:.||   |:|..:.||.|..:| ::||..
  Fly   160 RSLREILRTYPSLDGIDLDWEFPSAYDRERMH--LSQLLY---EIRTEWRREKRTNDILSLAVAA 219

  Fly   194 AKFRLNEGYHVPELCEALDAIHAMTYDLR--GNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLAL 256
            .:......|.:.|:....|.::.|:||..  .....|..:::|||.|..::......|:|..:..
  Fly   220 PEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQW 284

  Fly   257 WEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNAS--GFLAYYEICT 319
            |.:.|....:||||:|.||.:|||.|.         :|...|..|.| |....  ||....|.| 
  Fly   285 WLKSGLEPQRLVVGLPTYGHSFTLVNP---------LNHRIGAPASG-YGKCGQLGFTTLTETC- 338

  Fly   320 EVMDKSKGWTVEWDDAGMVPYTYKDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHGM 384
            |.:.|.....:.:|.....||.....:|:.|||:.||..|.:::|.....|.|.::::.||....
  Fly   339 ECVTKFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS 403

  Fly   385 CGRKNGLTQILYDNMKNYRVP 405
            |.        :..|:|....|
  Fly   404 CS--------IMPNLKYSEKP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 106/359 (30%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 108/376 (29%)
Trypan_PARP 367..469 CDD:114603 8/39 (21%)
CBM_14 531..578 CDD:279884
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 106/359 (30%)
GH18_chitinase-like 69..428 CDD:299167 111/386 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4712
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.