DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and Chil6

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:398 Identity:146/398 - (36%)
Similarity:212/398 - (53%) Gaps:41/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASRIVCYFSNWAVYRTGIGRYGLEDVPADLCTHIIYSFIGVNDKSWD---VLVIDPELDVDQGGF 87
            |.:::|||:||..::..:.....||:...||||:||||.|:    |:   .:....||| |..||
Mouse    38 AYQLMCYFNNWPQHQPDVRDIKHEDIDPCLCTHLIYSFAGI----WENNFTMTKRKELD-DYKGF 97

  Fly    88 S---------KFTQLKKSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQYNFD 143
            :         :|......|..:|..:::|.|..|...:..||:..:.|.|||.|:::|:::|.||
Mouse    98 NDLKKRQHLWRFIHASFRNNKLKTLLSIGCWNFGDGSFITMVSTPENRHSFITSIIKFLRKYGFD 162

  Fly   144 GFDLDWEYPGATDRGGNYG----DKDKFLYFVEELRRAFDREGRGWE-----ITMAVPVAKFRLN 199
            |.:|.|:|||.      ||    ||..|...:.|:|:||::|....:     :|.||......:.
Mouse   163 GLNLAWQYPGC------YGSPPRDKHLFTILMHEIRKAFEKEVSKNKKPRLMVTAAVAGVISTIQ 221

  Fly   200 EGYHVPELCEALDAIHAMTYDLRGNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPA 264
            .||.:|:|.::||.|..|||||.|:|.|:...:|||||...:.......|:...:..|::.|...
Mouse   222 FGYEIPQLSQSLDYIQVMTYDLHGSWDGYTGENSPLYKSPIETGVKAFHNIKYIMDNWKKKGASP 286

  Fly   265 NKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFLAYYEICTEVMDKSKGWT 329
            .||:||.|.||.||.||:|.|. .:|...|:   ||.|||:|..:||.|||||||.:   ..|..
Mouse   287 EKLIVGFPAYGHTFILSDSTKT-EIGAPSNR---GGHPGPHTKQTGFWAYYEICTFL---KNGAI 344

  Fly   330 VEWDDAGMVPYTYKDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHG-MCGRKN-GLT 392
            ..|:.|..|||.:...:||||:|..|..||..::|:..|.|||.|.|||||:.| .||:.. .||
Mouse   345 QVWNAAQQVPYAFHGNEWVGYDNIKSFHIKAQWLKRNNYGGAMIWTIDMDDYTGSFCGQGTFPLT 409

  Fly   393 QILYDNMK 400
            .||...:|
Mouse   410 SILKKTLK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 134/371 (36%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 144/390 (37%)
Trypan_PARP 367..469 CDD:114603 18/36 (50%)
CBM_14 531..578 CDD:279884
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 144/392 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.