DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and chil-18

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_496024.2 Gene:chil-18 / 187735 WormBaseID:WBGene00011161 Length:429 Species:Caenorhabditis elegans


Alignment Length:377 Identity:81/377 - (21%)
Similarity:162/377 - (42%) Gaps:68/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIVCYFSNW---AVYRTGIGRYGLEDVPADLCTHIIYSFIGVNDKSWDVLVIDPELDVDQGGFSK 89
            |:|.|:|.|   .:.|:.:|:          .||.:::||.::.:.        :|........:
 Worm    70 RVVGYYSEWEGTEITRSQLGK----------LTHAVFAFIHMDSEG--------KLQFKTNQKER 116

  Fly    90 F----TQLKKSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWE 150
            |    |.:|.:|.:.|:.|::|| ......:..:::..:::..||.|:.||::|:...|.|:.|:
 Worm   117 FEKLKTAVKNANSDTKVMISIGG-DHNSENFGSVLSDSEKKSMFIDSIARFIRQHKIHGVDIYWK 180

  Fly   151 YPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWEITMAVPVAKF-RLNEGYHVPELCEALDAI 214
            :.|.::.     :...|..|:::|:...........|::..|.||. |.::||...:..|.:|.:
 Worm   181 WLGNSET-----EHHDFPSFLKDLKEKLKTVRDDSIISIVAPQAKMDRRHDGYKFDDFMEYIDFV 240

  Fly   215 HAMTYDLRG----NWAGFADVHSPLY----KRKHDQYAYEKLNVNDGLALWEEMGCPANKLVVGV 271
            :..:.|..|    .|.......:|||    .:||       .||:..:..:..|....:|..:.:
 Worm   241 NVFSMDYYGPWPNQWGTPTGPSAPLYGGIGVKKH-------FNVDSTMKYYTCMTEDPSKFNMVI 298

  Fly   272 PFYGRTFTLSNSNKNYNMGTYINKEA---GGGAPGPYTNASGFLAYYEICTEVMDKSKGWTVE-- 331
            |||.|.:  .|..:..:.||.:.:.|   .|.|.|     :.:::.:.:..|      ||.:.  
 Worm   299 PFYVRLW--KNVKEPISSGTEVFRRADLKNGAAVG-----NSYMSRWTVDHE------GWELTPA 350

  Fly   332 -WDDAGMVPYTYKDT--QWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDD 380
             |||....||.:...  .::.:||:.||:.|:.:..:....|.....:|.|:
 Worm   351 LWDDVTKTPYVWNQETGNFLTFENKKSIEAKLAYAIEHNLGGVWIHLVDKDN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 80/374 (21%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 80/376 (21%)
Trypan_PARP 367..469 CDD:114603 3/14 (21%)
CBM_14 531..578 CDD:279884
chil-18NP_496024.2 Glyco_18 70..401 CDD:214753 80/374 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.