DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and K08F9.3

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:237 Identity:47/237 - (19%)
Similarity:92/237 - (38%) Gaps:69/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YIPLLLLGVLC----SWPAATVASDQASR-IVCYFSNWAVYRTGI-GRYGLEDVPADLCTHIIYS 62
            ::.:|:.|:..    |....:...||..: ::.|::       || ||..||:...:| ||.:::
 Worm    94 FLFVLIFGIYSLVSHSGHVQSTTPDQCDKQLIGYYN-------GIEGRNILENQFHNL-THAVFT 150

  Fly    63 FIGVNDKSWDVLVIDPELDVDQGGF------SKFTQLKK----SNPNVKLEIAVGGWAEGGSKYS 117
            ...||               :.|.|      .:|.:.:|    ||...|:.||: |:.:|..|  
 Worm   151 SEFVN---------------ENGSFENSHKEQEFLECRKKLGESNSTAKIMIAM-GFNKGSCK-- 197

  Fly   118 QMVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREG 182
                        |..:..|:::|..||.:|.|          |:.:     :|:.:|....:.:.
 Worm   198 ------------IDCITSFIEKYQVDGVELHW----------NHNE-----HFLSQLETTRNLKN 235

  Fly   183 RGWEITMAVPVAKFRLNEGYHVPELCEALDAIHAMTYDLRGN 224
            |..:|:.:..:.....:....|.||.:.|:....:..:|..|
 Worm   236 RLKKISNSKLLGVSASSNWSRVTELDQVLEVADFVNIELHDN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 42/209 (20%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 42/207 (20%)
Trypan_PARP 367..469 CDD:114603
CBM_14 531..578 CDD:279884
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 40/202 (20%)
GH18_chitinase-like 124..276 CDD:299167 41/204 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.