DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and chil-6

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_496126.1 Gene:chil-6 / 182436 WormBaseID:WBGene00007471 Length:460 Species:Caenorhabditis elegans


Alignment Length:409 Identity:88/409 - (21%)
Similarity:146/409 - (35%) Gaps:127/409 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PAATVASDQASRIVCYFSNWAVYRTGIGRYGLEDVP-----ADLCTHIIYSFIGVNDKSWDVLVI 76
            |||:.    ..|||.||:.:            |:.|     ..:.|||||.|....:.|....  
 Worm   106 PAASC----GKRIVGYFAEF------------ENSPLSKKQLQMLTHIIYLFAIPKNGSLTFR-- 152

  Fly    77 DPELDVDQGGFSKFTQLK----KSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFM 137
                  |:....||..:|    |.:..:|:.|::||....| ::|.:|:....|..|..|:|.|:
 Worm   153 ------DESSRRKFVAMKNEARKESSTLKVMISIGGQYSSG-EFSGLVSKETSRNLFTNSIVSFV 210

  Fly   138 KQYNFDGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAF----DREGRGWEITMAVPVAKFRL 198
            :.|:.||.|:.|.:|       .|.|::.:|.|:.|||.||    .:..|.....:::.::: .:
 Worm   211 QNYDIDGVDIFWTWP-------KYSDENNYLMFIRELRYAFTELQKKLNRKETFVISLVISR-NV 267

  Fly   199 NEGYHVPELCEALDAIHAMTYDLRGNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCP 263
            |   |:..|.|.            .|:..|.::           |.:...               
 Worm   268 N---HLSNLVEF------------SNFVDFLNI-----------YLFNSF--------------- 291

  Fly   264 ANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFLAYYEICTEVMDKSKGW 328
            .|::....|.||....:.:.|..|    ||.|   .|.|..:.....|.|.|....|:..:....
 Worm   292 LNQIGPDSPLYGGGSRIVDENMKY----YICK---SGQPSKFNIIVSFHATYWNGAELPLRDDSD 349

  Fly   329 TVEWDD--AGMVP----------YTYK--------------------DTQWVGYENEASIQIKMD 361
            .: |.|  :|.:|          |.:.                    .|:::..|.|.|::.|..
 Worm   350 DI-WKDNNSGRLPIALPRRQLRQYNWNLTDIKFHNLTKTSYIWIPGPPTRFMTLEEERSLREKNR 413

  Fly   362 FIKQRGYAGAMTWAIDMDD 380
            ::......|...|.||.||
 Worm   414 YVADHNIGGITMWTIDQDD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 83/395 (21%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 84/397 (21%)
Trypan_PARP 367..469 CDD:114603 6/14 (43%)
CBM_14 531..578 CDD:279884
chil-6NP_496126.1 Glyco_18 113..431 CDD:214753 83/395 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.