DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and chil-5

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_496127.1 Gene:chil-5 / 182435 WormBaseID:WBGene00007470 Length:459 Species:Caenorhabditis elegans


Alignment Length:390 Identity:89/390 - (22%)
Similarity:159/390 - (40%) Gaps:89/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PAATVASDQASRIVCYFSNWAVYRTGIGRYGLEDVPADLCTHIIYSFIGVNDKSWDVLVIDPELD 81
            |||..    ..|||.||:.:.  ..|:.|..|.     :.|||||.|....:   .|:.:|.|..
 Worm   105 PAAFC----GKRIVGYFAEFE--NAGLSRKQLH-----MLTHIIYLFARPTN---GVITLDGEQT 155

  Fly    82 VDQGGFSKFTQLK----KSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQYNF 142
                 ..||.::|    :::..:|:.|:||| .:...:||::|:....|..|::|:|.|.|:.:.
 Worm   156 -----RRKFEEMKSKAREASSTLKVMISVGG-HDYYKEYSRLVSNETSRNVFVKSIVSFFKKNDI 214

  Fly   143 DGFDLDWEYPGATDRGGNYGDKDKFLYFVEELRRAFDREGRGWE------ITMAVPVAKFRLNEG 201
            ||.::.|..|       .|.|...:..|::|||.||....:.|.      |::.||..|.     
 Worm   215 DGIEIFWTRP-------KYEDIKSYSSFIQELRSAFTELQKRWNRKNEYIISLIVPKEKH----- 267

  Fly   202 YHVPELCEALDAIHAMTYDLR--GNWAGFADVHSPLYKRKH-----DQYAYEKLNVNDGLALWE- 258
                           .::||:  ..:..|.:::|..::.|.     ..|..|..|:::.:..:. 
 Worm   268 ---------------WSFDLKDFSKFVDFFNIYSTQFREKQVGPDSPLYGGEGRNIDETMKYYIC 317

  Fly   259 EMGCPANKLVVGVPFYGRTF--TLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFLAYYEICTEV 321
            :.|.| :|..:.|.|:| ||  ......::|:...:..|..   |.||:......|         
 Worm   318 KTGQP-SKFNIMVSFHG-TFWEGAELPLRDYSDDIWKEKNV---ARGPFAVRWRHL--------- 368

  Fly   322 MDKSKGWT---VEWDDAGMVPYTY---KDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDD 380
              :.:.|.   :::.:.....|.:   ..|.::..|:|.|::.|..::......|...|.||.||
 Worm   369 --RQRNWNLTDIKFHNLTKTSYIWIPGPPTWFLTLEDEKSLREKNRYVADHNIGGITMWTIDQDD 431

  Fly   381  380
             Worm   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 84/376 (22%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 85/378 (22%)
Trypan_PARP 367..469 CDD:114603 6/14 (43%)
CBM_14 531..578 CDD:279884
chil-5NP_496127.1 Glyco_18 112..430 CDD:214753 84/376 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.