DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and chil-2

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:400 Identity:89/400 - (22%)
Similarity:164/400 - (41%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIVCYFSNWAVYRTGIGRYGLEDVPADLCTHIIYSFIGV---NDKSWDVLVIDPELDVDQGGFSK 89
            |:|.|.:.:      :..:.|:.:     ||.|::.|.:   ....|      |..:    .|..
 Worm    42 RVVAYSAKF------LSNHQLKKL-----THFIFTSISIFPNGTIKW------PNCE----NFES 85

  Fly    90 FT-QLKKSNPNVKLEIAVGGWAEGGSKYSQMVAVRDRRQSFIRSVVRFMKQYNFDGFDLDWEYPG 153
            :. :.|..|||:|:.:.:.|      |:..::|..:::.|||:|:..|:..:.|||.|:.|.:| 
 Worm    86 YARKAKMDNPNLKIMVEING------KFFSVLAEDEKKNSFIKSISSFVVDHKFDGVDIFWSWP- 143

  Fly   154 ATDRGGNYGDKDKFLYFVEELRRAFDREGRGWEITMAVPVAKFRLNEGYHVPELCEALDAIHAMT 218
                    .|:|.|..|::|.|...::.   ..|::|:|....:| ||:::..|...:|.::.::
 Worm   144 --------EDEDTFHLFIKEFREKLEKH---MIISIAIPRLAQQL-EGFNLKLLMNHIDFLNVLS 196

  Fly   219 YD----LRGNWAGFADVHSPLYKRKHDQYAYEKLNVNDGLALWEEMGCPANK---LVVGVPFYGR 276
            .:    |.||.|....: |||       |..::.||:..|   :.:.|...:   |.:||.|.|.
 Worm   197 INYYEPLPGNGANIGPI-SPL-------YGGQRGNVDGTL---KYLTCITKRPSILNMGVTFTGI 250

  Fly   277 TF--TLSNSNKNYNMGTYINKEAGGGAPGPYTNASGFLAYYEICTEVMDKSKGW---------TV 330
            .:  .....|:..::......|.|.|                       ||.||         |:
 Worm   251 FWNGVKDGLNEQDDIWKVAQNENGPG-----------------------KSIGWRKFIKDRRNTI 292

  Fly   331 -EWDDAGMVPYTY--KDTQWVGYENEASIQIKMDFIKQRGYAGAMTWAIDMDDFHG--------- 383
             :|.|:....|.:  |...::.:|||.|:..|:.:::.:...|.:.|.:|.||...         
 Worm   293 PQWHDSSKSSYAWDPKSKIFLAFENEKSLSEKVIYVRNKNIGGLVIWNVDQDDNDNSLLNALTSM 357

  Fly   384 -MCGRKNGLT 392
             ||.|.:|.|
 Worm   358 DMCARGSGGT 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 82/375 (22%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 87/398 (22%)
Trypan_PARP 367..469 CDD:114603 9/35 (26%)
CBM_14 531..578 CDD:279884
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 82/375 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1289629at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.