DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht5 and CTBS

DIOPT Version :9

Sequence 1:NP_650314.1 Gene:Cht5 / 41687 FlyBaseID:FBgn0038180 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:272 Identity:67/272 - (24%)
Similarity:113/272 - (41%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RQSFIRSVVRFMKQYNFDGFDLDWEY------PGATDRGGNYGDKDKFLYFVEELRRAFDREGRG 184
            |.|:|...:...|....||.::|.|.      |          :.|.....|:|...:|.||..|
Human   119 RASWIAQKLNLAKTQYMDGINIDIEQEVNCLSP----------EYDALTALVKETTDSFHREIEG 173

  Fly   185 WEITMAVPVAKFRLNEG-YHVPELCEALDAIHAMTYDLRGN-WAG-FADVHSPLYKRKHDQYAYE 246
            .::|..|..:...::.. |:...:.:|.|.:..|:||.:.. |:. .|..::|..:.......|.
Human   174 SQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYI 238

  Fly   247 KLNVNDGLALWEEMGCPANKLVVGVPFYGRTFTLSNSNKNYNMGTYINKEAGGGAPGPYTNASGF 311
            |:::|            ..|||:|||:||..:|..|.::::  ...|.|....||  |.::|:|.
Human   239 KMSIN------------PKKLVMGVPWYGYDYTCLNLSEDH--VCTIAKVPFRGA--PCSDAAGR 287

  Fly   312 LAYYEICTEVMDKSKGWTVEWDDAGMVP-YTYKDT----QWVGYENEASIQIKMDFIKQRGYAGA 371
            ...|:...:.::.|....: ||.....| |.|||.    ..|.|:|..||.:|..:|:.....|.
Human   288 QVPYKTIMKQINSSISGNL-WDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRGI 351

  Fly   372 MTWAIDMDDFHG 383
            ..|..:..|:.|
Human   352 GMWNANCLDYSG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht5NP_650314.1 Glyco_18 28..379 CDD:214753 65/266 (24%)
GH18_chitolectin_chitotriosidase 29..397 CDD:119351 67/272 (25%)
Trypan_PARP 367..469 CDD:114603 4/17 (24%)
CBM_14 531..578 CDD:279884
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 67/272 (25%)
Glyco_18 <115..358 CDD:214753 65/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.