DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CDC34

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_005259747.1 Gene:CDC34 / 997 HGNCID:1734 Length:269 Species:Homo sapiens


Alignment Length:163 Identity:86/163 - (52%)
Similarity:107/163 - (65%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRP 69
            |.:|||  :|..||..|||||...||.:.|::.|||.|.|||:|.||||:|||.|.||.:||..|
Human    10 QKALLL--ELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSP 72

  Fly    70 PKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDE 134
            |..:|:|::|||||.:.|||||||||.|.||....|...|||.|...|.||||||||:|.:||..
Human    73 PAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTF 137

  Fly   135 SAANVDAAKEYRENYAEFK---RKVTRCVRRSQ 164
            |.|||||:..||: :.|.|   |:.|..:|..:
Human   138 SPANVDASVMYRK-WKESKGKDREYTDIIRTQE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 86/160 (54%)
UQ_con 10..160 CDD:278603 82/152 (54%)
CDC34XP_005259747.1 COG5078 6..162 CDD:227410 84/154 (55%)
UBCc 11..162 CDD:238117 83/153 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.