DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and CDC34

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:73/165 - (44%)
Similarity:108/165 - (65%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASLLLNRQLSEL--QRHPVEGFSAGLVSDSDIFKWEV-VIIGPPDTLYEGGFFKAHLIFPKEYPL 67
            ||.||.||..||  .:..:..|...|..||:||.|.: |::...|::|.||||||.:.||:::|.
Yeast     8 ASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPF 72

  Fly    68 RPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPN 132
            .||:.:|...|:|||:.:.|.:||||||:.||.... |...|.|.||.|||::|:|::|:|.|||
Yeast    73 SPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTD-EPDAETWSPVQTVESVLISIVSLLEDPN 136

  Fly   133 DESAANVDAAKEYRENYAEFKRKVTRCVRRSQEEV 167
            ..|.||||||.:||:|..::|::|...|.||::::
Yeast   137 INSPANVDAAVDYRKNPEQYKQRVKMEVERSKQDI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 71/159 (45%)
UQ_con 10..160 CDD:278603 67/152 (44%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 73/162 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.