DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and UBC7

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_568902.3 Gene:UBC7 / 836048 AraportID:AT5G59300 Length:166 Species:Arabidopsis thaliana


Alignment Length:161 Identity:106/161 - (65%)
Similarity:131/161 - (81%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QASLLLNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRP 69
            ||||||.:||.:|.:|||:|||||||.:.:||:|.|.||||||||||||||.|.:.||:.||..|
plant     4 QASLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSP 68

  Fly    70 PKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDE 134
            |.::|.:::||||:...|.|||||||.||||..|||.|.|||.||||||:|:||:||||:.||||
plant    69 PTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPNDE 133

  Fly   135 SAANVDAAKEYRENYAEFKRKVTRCVRRSQE 165
            |.|||:||||:|:...|||:||:||||:|||
plant   134 SPANVEAAKEWRDKRDEFKKKVSRCVRKSQE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 103/157 (66%)
UQ_con 10..160 CDD:278603 95/149 (64%)
UBC7NP_568902.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I691
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 241 1.000 Inparanoid score I1079
OMA 1 1.010 - - QHG54250
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0003121
OrthoInspector 1 1.000 - - mtm1144
orthoMCL 1 0.900 - - OOG6_101758
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.