DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and MMZ3

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_850259.1 Gene:MMZ3 / 818179 AraportID:AT2G36060 Length:146 Species:Arabidopsis thaliana


Alignment Length:138 Identity:42/138 - (30%)
Similarity:62/138 - (44%) Gaps:32/138 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RQLSELQRHPVEGFSAGLVS-----DSDIF--KWEVVIIGPPD-TLYEGGFFKAHLIFPKEYPLR 68
            |.|.||:|.. :|...|.||     ..||:  .|...||||.: |::||..::..|...|:||.:
plant    16 RLLEELERGE-KGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEK 79

  Fly    69 PPKMKFITEIWHPNIDKAGDVCISILHEPG---DDKWGYEKAEERWLPVHTVETILLSVISMLTD 130
            ||.::|     |..|:.   .|::  |:.|   ..|:|   ....|...:|:|.|       ||.
plant    80 PPTVRF-----HSRINM---TCVN--HDTGVVDSKKFG---VLANWQRQYTMEDI-------LTQ 124

  Fly   131 PNDESAAN 138
            ...|.||:
plant   125 LKKEMAAS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 42/138 (30%)
UQ_con 10..160 CDD:278603 42/138 (30%)
MMZ3NP_850259.1 UBCc 16..143 CDD:214562 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.