DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and Ube2b

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_006246405.1 Gene:Ube2b / 81816 RGDID:708345 Length:180 Species:Rattus norvegicus


Alignment Length:154 Identity:57/154 - (37%)
Similarity:89/154 - (57%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            |.|....||..|..|.| |..|:::|.:|..||.||..|.:|.|.||..:.|.:|||.:||.::|
  Rat    37 LMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRF 100

  Fly    75 ITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANV 139
            :::::|||:...|.:|:.||             :.||.|.:.|.:||.|:.|:|.:||..|.||.
  Rat   101 LSKMFHPNVYADGSICLDIL-------------QNRWSPTYDVSSILTSIQSLLDEPNPNSPANS 152

  Fly   140 DAAKEYRENYAEFKRKVTRCVRRS 163
            .||:.|:||..|::::|:..|.:|
  Rat   153 QAAQLYQENKREYEKRVSAIVEQS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 56/152 (37%)
UQ_con 10..160 CDD:278603 55/149 (37%)
Ube2bXP_006246405.1 UQ_con 36..173 CDD:395127 55/149 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.