DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and UBC29

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_565391.1 Gene:UBC29 / 816175 AraportID:AT2G16740 Length:148 Species:Arabidopsis thaliana


Alignment Length:142 Identity:50/142 - (35%)
Similarity:84/142 - (59%) Gaps:14/142 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFIT 76
            ::|.||||.|....|||...: |:|.|:..|:||.::.|.||.|..::.||.:||.:|||:.|.|
plant     8 KELKELQRDPPVSCSAGPTGE-DMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRT 71

  Fly    77 EIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDA 141
            :::||||:..|::|:.||             :::|.|..|:..:|||:.|:|||||.:.....:.
plant    72 KVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLSICSLLTDPNPDDPLVPEI 123

  Fly   142 AKEYRENYAEFK 153
            |..|:.:..:::
plant   124 AHIYKTDKTKYE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 50/142 (35%)
UQ_con 10..160 CDD:278603 50/142 (35%)
UBC29NP_565391.1 UBCc 1..146 CDD:381827 50/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.