DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc87F and ube2t

DIOPT Version :9

Sequence 1:NP_650309.1 Gene:Ubc87F / 41682 FlyBaseID:FBgn0267383 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001070763.1 Gene:ube2t / 768152 ZFINID:ZDB-GENE-061013-547 Length:194 Species:Danio rerio


Alignment Length:164 Identity:51/164 - (31%)
Similarity:83/164 - (50%) Gaps:15/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNRQLSELQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKF 74
            |.|::..|...|..|.|. ..|:..:.:.:..|:|..:|.||||.|...:..|:.||..||||:|
Zfish     7 LKREMQLLTAEPPPGVSC-WQSEGRLDELQAQIVGGANTPYEGGVFTLEINIPERYPFEPPKMRF 70

  Fly    75 ITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANV 139
            :|.|:|||||.||.:|:..|..|         .:..|.|...:.|:|.|:..::.:||.:.....
Zfish    71 LTPIYHPNIDNAGRICLDALKLP---------PKGAWRPSLNISTVLTSIQLLMAEPNPDDPLMA 126

  Fly   140 DAAKEYREN---YAEFKRKVT--RCVRRSQEEVE 168
            |.:.|::.|   |.|..:|.|  ..:::::..||
Zfish   127 DISSEFKYNKPLYLEKAKKWTAEHAIQKNKGCVE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc87FNP_650309.1 COG5078 1..163 CDD:227410 49/157 (31%)
UQ_con 10..160 CDD:278603 49/154 (32%)
ube2tNP_001070763.1 COG5078 1..152 CDD:227410 49/154 (32%)
UBCc 4..147 CDD:238117 48/149 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.